KEGG   Vanderwaltozyma polyspora: Kpol_1023p45Help
Entry
Kpol_1023p45      CDS       T01049                                 

Definition
(RefSeq) hypothetical protein
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
vpo  Vanderwaltozyma polyspora
Pathway
vpo00330  Arginine and proline metabolism
vpo00332  Carbapenem biosynthesis
vpo01100  Metabolic pathways
vpo01130  Biosynthesis of antibiotics
vpo01230  Biosynthesis of amino acids
Module
vpo_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:vpo00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Kpol_1023p45
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    Kpol_1023p45
Enzymes [BR:vpo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     Kpol_1023p45
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AA_kinase PUA
Motif
Other DBs
NCBI-GeneID: 5547192
NCBI-ProteinID: XP_001646734
UniProt: A7TFR8
AA seq 441 aa AA seqDB search
MLEEQGFESQDKENMPNTYTIVIKVGSSSLVDEQTKEPKLAIMSKLVETVVRLRRAGHKV
AIVSSGGIAVGLRALGLPKKPKHISEIQAIAAVGQGRLIGRWDLLFSQFNQRIAQVLLTR
TDIMYWRQYRNAQNTLNELLKMGVVPIINENDTLSISEIKFGDNDTLSAITASIVGADYL
FLLTDVDCLYTDNPRTNPDATPILIVPDISKGLPGVKIDSGGGSSVGTGGMETKLVAADL
ATNAGVHTIVMKSDVPENINKIVDYIQSLDINLSGNGEKKIEEENGCDLFELQRKELERL
EEMEVPLHTKFLANDDNHHLKNREFWILHGLVANGAVIIDEGAYKALTRRNKAGLLPAGV
IEVEGSFHELECVELKIGKRLPNGELDTSIPLRTCGKARCDYSSIEISRIKGLQSDEIEN
ELGYADSEYVAQRENMAFPPN
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgttagaagagcaggggtttgaaagtcaagacaaagaaaatatgccaaatacatatact
attgttattaaagtaggttcctcatcgttagtcgatgagcagactaaggagcctaagttg
gctattatgtctaaattagttgagactgtagttagactgagacgggctggtcataaagtt
gctattgtttctagtggtggtattgctgttgggttgagggcattaggtttgcctaaaaag
cctaaacacatatctgagattcaggctatcgcagctgtgggtcaaggtagattgattggt
agatgggatttattattttcccagttcaatcaaagaattgcccaagttttattaactaga
actgatataatgtattggagacagtatagaaatgctcaaaatacattaaatgagttgttg
aagatgggtgttgttccaattattaatgagaacgataccttatctattagtgaaattaaa
tttggtgataatgatacattatctgccattacagcatcaatcgttggggctgactattta
ttccttttgactgatgtcgactgtttatatactgataatccaagaaccaatccggatgct
actccaatcttaattgttccagatatttcaaaagggttgccaggtgtgaagattgacagc
ggtggtggctcttcagtcggtactggtggtatggagactaagttagttgccgctgattta
gctaccaatgctggtgttcatacaatcgtgatgaagagtgatgttcctgaaaatattaac
aagattgtggattatattcaaagtcttgatataaacttaagcggtaatggtgaaaagaaa
attgaagaagaaaatggttgtgatttatttgaattacagaggaaagaattggaaagattg
gaagagatggaggttcctttacatacgaaatttttagccaatgacgacaaccatcatttg
aagaatcgtgagttttggattcttcatggcttagtagcgaacggtgctgttattatcgat
gaaggtgcatataaagcattgacacgtagaaacaaagccggtttattaccagcaggtgtt
attgaagttgaaggttcattccacgaattagaatgtgttgaattgaaaattggtaagagg
ttaccaaatggtgagttagacacatcgattccattacgtacatgtggtaaagctcgttgt
gattattcaagtattgaaattagcagaattaaaggtttgcaaagtgatgaaattgaaaat
gaattagggtacgccgacagtgaatatgttgctcaaagagaaaacatggctttcccacca
aattga

DBGET integrated database retrieval system