KEGG   Vanderwaltozyma polyspora: Kpol_1023p74Help
Entry
Kpol_1023p74      CDS       T01049                                 

Definition
(RefSeq) hypothetical protein
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
vpo  Vanderwaltozyma polyspora
Pathway
vpo00230  Purine metabolism
vpo01100  Metabolic pathways
Module
vpo_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:vpo00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Kpol_1023p74
Enzymes [BR:vpo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Kpol_1023p74
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_kin AAA_16 MMR_HSR1 AAA_33 AAA_22 AAA_24 AAA_18 RNA_helicase AAA_28 AAA ABC_tran AAA_29 AAA_14 NACHT RsgA_GTPase Rad17 AAA_30 T2SSE DUF2075 NTPase_1 AAA_19 AAA_5 ATPase_2 AAA_2 cobW Viral_helicase1 Adeno_IVa2 KAP_NTPase Cytidylate_kin AAA_23 dNK
Motif
Other DBs
NCBI-GeneID: 5547222
NCBI-ProteinID: XP_001646763
UniProt: A7TFU7
AA seq 187 aa AA seqDB search
MPRPIVISGPSGTGKSTLLKKLFAEYPTSFGFSVSSTTRGPRPGEVNGKDYNFVKVDDFQ
GMIDSGDKFIEWAQFSGNYYGTTVESVHKVIDSGKTCILDIDMQGVKAVKSKPQLNARFL
FVAPPSMDDLKTRLVGRGTETEESISKRLAAADAEMAYAASGAHDKIIVNDDLDKAYREL
KEFVFQH
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atgcctcgtcctattgttatttcaggtccaagtggtactggtaagtctactttgttgaaa
aagttatttgcagaatatcctacatctttcgggttctctgtttcttctaccactagaggc
ccaagaccaggtgaagtcaatggtaaggattacaattttgtcaaggtcgatgatttccaa
ggtatgatcgattcaggtgataagttcattgaatgggctcaattttctggtaactattac
ggtactacagttgaatctgtccataaggtcattgattctggtaagacttgtatcttggat
attgatatgcaaggtgttaaagctgtcaagagcaagcctcagttgaatgctagattttta
ttcgttgctcctccttcaatggatgatttgaagactagattggtaggtagaggtactgag
actgaggaatccattagcaagagattggctgctgctgacgctgaaatggcttatgccgct
agtggtgctcacgataaaattattgtcaatgatgatttggacaaagcttacagagaattg
aaagaattcgttttccaacactaa

DBGET integrated database retrieval system