KEGG   Vanderwaltozyma polyspora: Kpol_1037p48Help
Entry
Kpol_1037p48      CDS       T01049                                 

Definition
(RefSeq) hypothetical protein
  KO
K15529  ADP-ribose 1''-phosphate phosphatase [EC:3.1.3.84]
Organism
vpo  Vanderwaltozyma polyspora
Brite
KEGG Orthology (KO) [BR:vpo00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Kpol_1037p48
Enzymes [BR:vpo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.84  ADP-ribose 1''-phosphate phosphatase
     Kpol_1037p48
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Macro
Motif
Other DBs
NCBI-GeneID: 5545671
NCBI-ProteinID: XP_001645309
UniProt: A7TJY9
AA seq 180 aa AA seqDB search
MIEMNNISYIKGNILHGGNIPRILIHSCNCNGTWGGGIAYQLAVHYPEAEKIYTDICDDF
GSELLGKCVLIPSFSDDSLLIGCLFTSVYGGSSHDTKNEILKYTKLSLMQLSLQLENNDS
CIDTCLSEYNQLLISNIKHHLKDYKLEMPKINSGIFNVPWEETEKILKELKPMEFTVFSI
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atgattgaaatgaataatattagttatattaaggggaacatattacatggaggtaatatt
cctaggattcttattcactcttgtaactgcaatggcacttggggtggtggaatagcttat
cagcttgctgtacactatcctgaagctgaaaaaatctacacggacatatgtgatgatttt
ggttctgaattgcttgggaaatgtgttctaatacctagctttagcgatgattcattatta
attggatgtcttttcacttcagtttatggtggatctagtcatgatactaaaaatgaaata
ttgaaatataccaaactatcactaatgcagctaagtctacaattagaaaataatgatagc
tgtatcgatacgtgtttaagtgaatataatcaattactaatatcaaatattaaacatcat
ttaaaggattataagctagaaatgccaaaaataaatagtgggatatttaatgtgccatgg
gaagagactgaaaagattttaaaagaattaaaacctatggagtttactgtatttagtata
tag

DBGET integrated database retrieval system