KEGG   Vanderwaltozyma polyspora: Kpol_1049p18Help
Entry
Kpol_1049p18      CDS       T01049                                 

Definition
(RefSeq) hypothetical protein
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
vpo  Vanderwaltozyma polyspora
Pathway
vpo00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:vpo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    Kpol_1049p18
Enzymes [BR:vpo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     Kpol_1049p18
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     Kpol_1049p18
    1.1.1.-  
     Kpol_1049p18
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C Pyr_redox_3 Pyr_redox_2 Pyr_redox NAD_binding_7 Prim_Zn_Ribbon RuvB_C 2-Hacid_dh_C
Motif
Other DBs
NCBI-GeneID: 5543854
NCBI-ProteinID: XP_001643618
UniProt: A7TPQ8
AA seq 386 aa AA seqDB search
MRALAYFGKGNVRFTYSLKEPHIHAEDDVIIDISWCGICGTDLKEYTDGAIFFPEDGCVN
HISNNNLPQAMGHEISGIISSVGPGCKKFKIGDHVVVEPTATCIDRYRWPNAPNRDTPMC
EACRNGMPNICKYLGLTGAGVEGGGFAEKMVINEHHCHKIPHHMPLDVASLIQPISVCWH
AVKVSHYKQGGSVLIVGGGPIGLGTILALKGFGCEDIVVSEPALIRRELAEKMGARVFDP
SNMSLDNSIKTLTEMAPGSQGFDYTFDCSGIPATLKVAIECCTFRGTAVNIAVWGHKPVE
FFPMDITSQEKRYTGSMCYTSEDFEEVIEAFKSKRIDINTARHLITGKVPIEEGIEGAML
RLLRDKGHTIKILLTPNNKNELGYKL
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgagagctttagcttattttggtaaaggtaatgtaagattcacttactcattaaaagaa
ccccatattcatgccgaagatgatgtaattattgacatctcttggtgtggtatttgtggg
acagatttaaaagaatatacagatggtgcaattttcttcccagaggatggatgcgtaaat
catattagtaataataatttaccacaagccatgggtcacgaaatatcaggaattatctct
agcgtcggtccaggttgtaaaaaattcaaaataggtgaccatgttgtcgttgaaccaaca
gctacatgtatagatagatatcgttggccaaatgctccaaatagagatacaccaatgtgc
gaagcttgtagaaatgggatgcctaatatttgcaaatatttaggtttaactggcgcaggt
gttgaaggtggtggattcgccgaaaaaatggttatcaatgaacatcactgtcataagatt
ccgcatcacatgcctttagatgtagcttccttaattcaaccaatttcagtttgctggcat
gcagttaaagtttcacattataagcaaggaggttcagtgctaattgtgggcggtggtcca
attggcttaggcacgatattggcattgaagggattcggttgtgaagatattgtggtttct
gaaccagctctaattagaagagaattagctgagaaaatgggtgcgagagtattcgaccct
tccaatatgtctctagacaattcaatcaaaactttgactgaaatggcaccaggcagccaa
ggtttcgattacacattcgattgttccggtatacccgctactctaaaggtagcaattgaa
tgttgcacatttagaggaactgcagttaatatcgcagtttggggccataaacctgttgaa
tttttccctatggatatcacatcacaagaaaaaagatatacaggctctatgtgttatact
agtgaagatttcgaagaagtcattgaagcgttcaaaagtaaacgtattgacatcaatact
gcaagacatttaatcacaggtaaagtacctattgaagaaggaattgaaggtgctatgtta
agattactgcgtgataaaggccatacaattaagattcttctaactccgaataataagaac
gaattaggctacaaattgtag

DBGET integrated database retrieval system