KEGG   Vanderwaltozyma polyspora: Kpol_1054p33Help
Entry
Kpol_1054p33      CDS       T01049                                 

Definition
(RefSeq) hypothetical protein
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
vpo  Vanderwaltozyma polyspora
Pathway
vpo03040  Spliceosome
vpo04141  Protein processing in endoplasmic reticulum
vpo04144  Endocytosis
vpo04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:vpo00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    Kpol_1054p33
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    Kpol_1054p33
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    Kpol_1054p33
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    Kpol_1054p33
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:vpo01009]
    Kpol_1054p33
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:vpo03041]
    Kpol_1054p33
   03009 Ribosome biogenesis [BR:vpo03009]
    Kpol_1054p33
   03110 Chaperones and folding catalysts [BR:vpo03110]
    Kpol_1054p33
   04131 Membrane trafficking [BR:vpo04131]
    Kpol_1054p33
   03051 Proteasome [BR:vpo03051]
    Kpol_1054p33
   03029 Mitochondrial biogenesis [BR:vpo03029]
    Kpol_1054p33
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:vpo04147]
    Kpol_1054p33
Protein phosphatases and associated proteins [BR:vpo01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     Kpol_1054p33
Spliceosome [BR:vpo03041]
 Complex B
  Other components
   Prp19 complex
    Kpol_1054p33
 Complex C
   Prp19-CDC5 complex
    Kpol_1054p33
Ribosome biogenesis [BR:vpo03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    Kpol_1054p33
Chaperones and folding catalysts [BR:vpo03110]
 Heat shock proteins
  HSP70 / DNAK
   Kpol_1054p33
Membrane trafficking [BR:vpo04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    Kpol_1054p33
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    Kpol_1054p33
Proteasome [BR:vpo03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    Kpol_1054p33
Mitochondrial biogenesis [BR:vpo03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    Kpol_1054p33
Exosome [BR:vpo04147]
 Exosomal proteins
  Proteins found in most exosomes
   Kpol_1054p33
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C
Motif
Other DBs
NCBI-GeneID: 5546250
NCBI-ProteinID: XP_001645844
UniProt: A7TIC0
AA seq 613 aa AA seqDB search
MAEGVFQGAIGIDLGTTYSCVATYESSVEIIANEQGNRVTPSFVAFTPEERLIGDAAKNQ
AALNPKNTVFDAKRLIGRRFDEEAVQEDMKTWPFKVIDAQGAPMIEVEYLGETKTFSPQE
ISSMVLTKMKEIAEAKIGKKVEKAVITVPAYFNDAQRQATKDAGAISGLNVLRIINEPTA
AAIAYGLGAGKSEKERHVLIFDLGGGTFDVSLLHIAGGVFTVKSTSGNTHLGGQDFDTNM
LEHFKAEFKKKTGLDISGDARALRRLRTAAERAKRTLSSVTQTTVEVDSLFEGEDFEASI
TRARFEDLNAALFKSTLTPVEQVLKDAKIAKSQIDEVVLVGGSTRIPKVQKLLSDFFDGK
QLEKSINPDEAVAYGAAVQGAILTGQSTSDETKDLLLLDVAPLSLGVGMQGDIFGIVVPR
NTTVPTIKRRTFTTVGDNQTTVQFPVYQGERVNCKENTLLGEFDLKNIPPMPAGEPVLEA
IFEVDANGILKVTAVEKSTGKSANITISNAVGRLSSDDIEKMVNQAEEFKAADEAFAKRH
EARQRLESYVASIEQTVTDPVLSSKMKRGSKSKIEAALSEAMAALEIEDSSAEDLRKAEV
GLKRVVTKAMSSR
NT seq 1842 nt NT seq  +upstreamnt  +downstreamnt
atggctgaaggtgttttccaaggtgctattggtatcgatttaggtactacctactcatgt
gttgctacttatgaatcttctgttgaaattattgctaacgaacaaggtaacagagttact
ccatctttcgttgctttcactccagaagaaagattgattggtgatgctgctaagaaccaa
gctgctttgaacccaaagaacactgtcttcgatgctaagcgtttgatcggtagaagattc
gacgaagaagctgtccaagaagatatgaagacttggccatttaaggtcattgacgctcaa
ggtgctccaatgatcgaagttgaatacttgggtgaaactaaaactttctccccacaagaa
atttcctccatggtcttgaccaagatgaaggaaattgctgaagctaagattggtaagaag
gtcgaaaaggctgttattactgtcccagcttatttcaacgatgctcaaagacaagcaacc
aaggatgccggtgctatctctggtttgaacgttttgcgtatcattaacgaaccaactgct
gctgccattgcttacggtttaggtgctggtaagtctgaaaaggaaagacatgtcttgatt
ttcgatttaggtggtggtactttcgatgtctccttgttgcacatcgctggtggtgtcttc
accgtcaagtctacctccggtaacactcacttgggtggtcaagatttcgataccaacatg
ttggaacacttcaaggctgaattcaagaagaagactggtttggacatctccggtgacgcc
agagctttgagaagattgagaactgctgctgaaagagctaagagaactttgtcttccgtc
actcaaaccaccgttgaagtcgactctttgttcgaaggtgaagatttcgaagcttctatc
accagagctagattcgaagacttaaacgctgctttgttcaaatctactttgaccccagtt
gaacaagtcttgaaggatgctaagatcgccaagtctcaaatcgatgaagttgtcttggtc
ggtggttctaccagaattccaaaggtccaaaaattattgtctgacttcttcgacggtaag
caattggaaaaatccattaacccagatgaagctgttgcttacggtgctgctgttcaaggt
gctatcttgaccggtcaatctacttctgatgaaaccaaggacttgttgttgttggatgtt
gctccattatccttaggtgttggtatgcaaggtgacatcttcggtatcgtcgttccaaga
aacactaccgtcccaaccatcaagagaagaactttcaccactgttggtgacaaccaaact
accgttcaattcccagtctaccaaggtgaacgtgttaactgtaaagaaaacactttgtta
ggtgaattcgacttgaagaacatcccaccaatgccagctggtgaaccagtcttggaagct
atcttcgaagttgatgctaacggtatcttgaaggttactgccgtcgaaaagtctactggt
aagtccgctaacattactatctctaacgctgtcggtagattgtcttctgacgatatcgaa
aagatggttaaccaagctgaagaattcaaggctgctgatgaagctttcgctaagagacac
gaagctagacaaagattggaatcttacgttgcttctatcgaacaaaccgtcactgaccca
gtcttatcttctaagatgaagagaggttctaaatccaagatcgaagctgctttgtctgaa
gctatggctgctttggaaattgaagactcttccgctgaagacttgagaaaggctgaagtt
ggtttgaagagagttgttaccaaggctatgtcctcccgttaa

DBGET integrated database retrieval system