KEGG   Vanderwaltozyma polyspora: Kpol_1056p14Help
Entry
Kpol_1056p14      CDS       T01049                                 

Definition
(RefSeq) hypothetical protein
  KO
K01724  4a-hydroxytetrahydrobiopterin dehydratase [EC:4.2.1.96]
Organism
vpo  Vanderwaltozyma polyspora
Pathway
vpo00790  Folate biosynthesis
vpo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vpo00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Kpol_1056p14
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:vpo04147]
    Kpol_1056p14
Enzymes [BR:vpo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.96  4a-hydroxytetrahydrobiopterin dehydratase
     Kpol_1056p14
Exosome [BR:vpo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Kpol_1056p14
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pterin_4a Toxin_trans
Motif
Other DBs
NCBI-GeneID: 5544985
NCBI-ProteinID: XP_001644671
UniProt: A7TLM1
AA seq 116 aa AA seqDB search
MYNKISRVAPVVLSKEQIALKLISLPHWKIENSKLVREPIEVRDFETACSLFNAIAMRSH
LWGHHPELTLNYNRLGIKLTTHDIGNQVSDIDLKLAKRIEKYVDMYKFEEGVAEEK
NT seq 351 nt NT seq  +upstreamnt  +downstreamnt
atgtataataagatttcccgagttgctccagttgtattgagtaaagaacagattgctttg
aagcttatatcgttacctcactggaagatcgaaaatagtaaattagtgcgagaaccgatt
gaagtgagagattttgagactgcttgttcgttgtttaatgccattgctatgaggtctcat
ctttggggccaccatcctgaattgacgttgaattacaatcggcttggaattaagttgacc
acacacgatattggcaatcaggtcagtgatattgatttgaaattagctaaaaggatcgaa
aagtacgtggatatgtacaaatttgaagaaggagttgcggaagaaaagtag

DBGET integrated database retrieval system