KEGG   Vanderwaltozyma polyspora: Kpol_1059p12Help
Entry
Kpol_1059p12      CDS       T01049                                 

Definition
(RefSeq) hypothetical protein
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
vpo  Vanderwaltozyma polyspora
Pathway
vpo00260  Glycine, serine and threonine metabolism
vpo01100  Metabolic pathways
vpo01110  Biosynthesis of secondary metabolites
vpo01130  Biosynthesis of antibiotics
vpo01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:vpo00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Kpol_1059p12
Enzymes [BR:vpo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     Kpol_1059p12
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2
Motif
Other DBs
NCBI-GeneID: 5544465
NCBI-ProteinID: XP_001644180
UniProt: A7TN16
AA seq 388 aa AA seqDB search
MSEFDLPLPYSGASNDFRSDTFTTPTKEMIEAALTASVGDAVYGEDSDTVLLEKTLAKMA
GMEAGLFCVSGTLSNQIALRTHLFQPPYSILCDYRAHIYTHESAGLAILSQAMVVPVIPS
NGNYLTLEDIKSHYVPDDGDIHGAPTKIISLENTLHGIVHPLEELVRIKAWCMENNLKLH
CDGARIFNAVAQAGVPLRQYGEIFDSISICLSKSIGAPIGSVLVGDLKFVKKANHFRKQQ
GGGIRQSGMISKMALVCVNGDWKTKLLYSHSLAHSLAAYCKEIGVPLESPADTNFVFIDL
AKARMDPDVLVKKGLKYGVKLMGGRVSFHYQISEQSLEKVKLAIGEAFEYSKAHPFNSNG
ATKIYRSESTEKMDVDGNAIHDVKTYKY
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaattcgatttacctttaccttattctggtgcttcaaacgatttccgttctgac
actttcaccactcctacaaaagagatgatcgaagctgctttgactgcttctgtcggtgat
gctgtttacggtgaagattctgacactgtcctattggaaaaaactttggccaaaatggca
ggtatggaagcaggtttgttctgtgtttcgggtaccttgtcaaaccaaatcgctttgaga
actcatttgttccaacctccatattccatcttatgtgattacagagctcacatctatact
catgaatctgctggtttggctatattgtctcaagctatggtcgttcctgtaattccttca
aacggtaactacttgaccctagaagatatcaaatctcactatgttccagacgatggtgac
attcacggtgctccaaccaagattatctctttggaaaatactttgcacggtatcgttcat
cctttggaagaattggttcgtattaaggcttggtgtatggaaaataacttgaaattacac
tgtgacggtgccagaatctttaacgctgttgcccaagctggtgtcccattaagacaatac
ggtgaaattttcgattccatctccatctgtttatccaaatccattggtgctccaatcggt
tccgtcttggttggtgacttgaaattcgtcaagaaggctaaccactttagaaagcaacaa
ggtggtggtattagacaatctggtatgatcagtaaaatggctttggtctgtgtcaacggt
gactggaaaactaagttattatattcccattccttggctcacagcttggccgcctactgt
aaagaaatcggtgttccattggaatctcctgctgataccaactttgtcttcatcgatttg
gctaaggctagaatggacccagatgttttggtaaagaaaggtttgaaatacggtgtcaaa
ttgatgggtggtagagtttctttccactaccaaatctccgaacaatctttggaaaaagtc
aagttggccatcggtgaagcttttgaatattcaaaagctcatcctttcaactctaacggt
gccactaagatttatcgtagtgaatccactgaaaagatggatgtagacggcaatgctatt
catgacgttaagacttacaaatattag

DBGET integrated database retrieval system