KEGG   Vanderwaltozyma polyspora: Kpol_1067p17Help
Entry
Kpol_1067p17      CDS       T01049                                 

Definition
(RefSeq) hypothetical protein
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
vpo  Vanderwaltozyma polyspora
Pathway
vpo00970  Aminoacyl-tRNA biosynthesis
vpo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vpo00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Kpol_1067p17
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:vpo03029]
    Kpol_1067p17
Enzymes [BR:vpo01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     Kpol_1067p17
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     Kpol_1067p17
Mitochondrial biogenesis [BR:vpo03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Kpol_1067p17
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-GeneID: 5544164
NCBI-ProteinID: XP_001643903
UniProt: A7TNW2
AA seq 467 aa AA seqDB search
MSYSRAIARLGALPELQKKFNAFTFVNEDATGQLVREGSQGTKSLSNVLVGVKDNIVTKD
MPTTCSSKILEDFKSPFDATVVELLKNEGAVIAGKTNLDEFGMGSSGIHSYFGPTTNPIF
ADVPTVVGGSSSGSAAAAAGGVVDFALGTDTGGSVRLPAAYTSILGFKPSYGRISRYGVI
AYAQSFDTVGILSKDISIVKQAFKILDKHDRKDPTSLGTELRELLPKDTGNSNGKLRIGL
PKEFVQESVPVSIRNKYLSFIENMKSKGHEIVPVSIPSVKHALPIYYTLVPSEASSNLSR
FDGVRYGTRDEHSDLVDNTLFAPTRQYFGKSVQERIILGNYNLCSGSYKNNYIKAQRLRV
QMVNEFDQVFKKSNVLTNSKGNNAGVDMLVCLTSVDKPKTLARALEESRLSSPVNEYITD
VFTLPMSLAGLPTISIPIEEGEPVGVQLVGQYGDDWGVLNLADSLLA
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atgtcttattccagggcaattgcgagactaggagctctgcctgagcttcagaagaagttc
aatgccttcacgtttgttaatgaggatgcaacgggacaattggttagagaaggtagtcaa
ggtacaaagagcctttctaacgttttggtgggtgtgaaggataatattgttactaaggat
atgcccactacgtgttcctcgaagatcttggaagatttcaagtccccatttgatgcaaca
gtggtagaattgctaaagaatgaaggtgctgttatagcaggcaagacaaacttagatgaa
tttggaatgggttcttctggtatacattcatattttggtcctacaacgaatcccatattt
gcggacgtgcctaccgtggtaggtggttcttcttcagggtcagcagcagcagcagctgga
ggcgtcgttgattttgctttggggacagacacaggtggatcggtaaggctaccagctgcg
tatacatctatattaggtttcaagccatcgtatggtagaatctccaggtatggtgtcata
gcttacgctcaatcttttgatacagttggaatcctgtcgaaagatatatctatcgtgaaa
caagccttcaagattcttgacaaacacgacaggaaggacccaacctctttgggcacagag
ttgagagaacttcttcctaaagatacaggtaatagcaacggcaagttacggattgggtta
cccaaggaatttgtacaagagtctgttccagtttctatcagaaataaatatttgtcattc
attgagaatatgaaatccaagggtcacgagatagttccagtctcaataccgtcagttaaa
catgcattgcctatttactatactttagtgccttcagaagcatcctctaatctatcccga
ttcgatggtgtgaggtatgggacaagagatgaacacagcgatctggtggataacacgttg
tttgcacctaccagacaatattttgggaaatcagtccaagaaagaataatattaggaaat
tacaacttatgttcaggttcatataagaataactatatcaaggcacagagattgagggtc
caaatggtaaacgaattcgaccaagtgttcaagaaatcaaatgtattgacgaattcgaaa
ggaaacaatgctggcgttgatatgctggtgtgcctaacttctgtagataagccaaaaacg
ttggcaagagcccttgaagaatccagattgtcttcacctgttaatgagtatataaccgat
gttttcacgttgccaatgtcgttggctggtttgccaacaatatcgattccaattgaagaa
ggagagcctgttggagtccaacttgttggccaatacggtgatgattggggggtattgaat
ctagcggattcattgttagcataa

DBGET integrated database retrieval system