KEGG   Vanderwaltozyma polyspora: Kpol_234p2Help
Entry
Kpol_234p2        CDS       T01049                                 

Definition
(RefSeq) hypothetical protein
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
vpo  Vanderwaltozyma polyspora
Pathway
vpo00052  Galactose metabolism
vpo00500  Starch and sucrose metabolism
vpo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vpo00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Kpol_234p2
   00500 Starch and sucrose metabolism
    Kpol_234p2
Enzymes [BR:vpo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     Kpol_234p2
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C
Motif
Other DBs
NCBI-GeneID: 5542424
NCBI-ProteinID: XP_001642290
UniProt: A7TTH6
AA seq 650 aa AA seqDB search
MKVTIESFVCFVSLYVSLVSSAAIELPTFTIPSYTIPSYTIPSYTIPSYTIPSYTIPSYT
IPSYTIPSYTIPSYTIPSYSIPSYSIPSYSIPSYTIPSFTTLTFSYETSIPIPSIPFTVS
SFNTTQDNKPLIHATPPEGWMNDPNGLWYDSKDELYHMYYQYNPNDTVWALPIVWGHKTS
KNLTIWDDAGIAMAPTDTITGFYSGSVVVDYNNTSGFFNSSTDPRQRAVAIYTYNTPEAE
VQCVAYSLDGGYSFIQYESNPVLSNNSTQFRDPKVIWHEESQKWIMTVAKTQEYKVAIYS
SSDLKDWTLESEVEKVGVLGYQYECPGLAKISLPDVVLESGSNNKTIPNSSSSKDAWVLF
ISINPGAPQGGSYVEYFIGDFNGTVFTPFSRETQALDDGKDYYAFQTFFNSPDNSTLGVA
WASNWQYGQYVPTYPWRSSMSLVRNLTLEYFQANPESKILKLKSQPVIDYDCFTSNSDVI
KFSNLSSLSTLDSIYSFSNSSEGILEFNLTWSVNSSSYDNHDFADLSLKLRGGLNPFEYL
RLGYLANVNSFFIDRGHSTNNWVNENPFYTNKLSVNLQPFDYVNDEISTYKVYGIIDRNI
MELYFNDGFQVSTNTFFFGDYNYISSVELSVGKDGVFDIQEFSVRQLHLK
NT seq 1953 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtgactatagaaagttttgtttgctttgtttctttatatgtaagcttggtatct
tcagcagcaattgaattacctacatttactattccatcctataccattccgtcctatact
atcccatcctatactatcccatcctatactatcccatcctatactatcccatcctatact
atcccatcctatactatcccatcctatactatcccatcctatactatcccatcatacagt
atcccatcatacagtattccatcatacagtattccttcctacacaattccatcatttaca
actttgacgttcagctatgaaacctcaatacctatcccttctataccatttacagtatcc
agttttaacactacacaagataataaaccattaattcatgctactccaccagagggttgg
atgaacgatccaaatggtctgtggtatgattcgaaggacgaactttatcatatgtattac
caatacaatccaaatgatacagtgtgggctttgccaattgtctggggtcacaagacttca
aagaatttaacaatctgggatgacgctggtattgccatggctccaaccgacaccattact
ggtttctactctggttctgttgttgttgattataacaatacttctggattcttcaattcc
tctactgatccaagacaaagagctgttgctatatacacgtacaacactccagaagctgaa
gttcaatgtgttgcttactctttagatggtggttactctttcattcaatatgaatctaat
ccggttttatctaataactctacccaattcagagatccaaaggttatctggcatgaagaa
tctcaaaaatggattatgactgttgctaagactcaagaatacaaggttgcaatttactct
tcatctgacttgaaggactggactttagaatctgaagttgaaaaggtcggtgttttgggt
taccaatatgaatgcccaggcttggctaagatttctctaccagatgtagtattggaatct
ggttcaaacaacaaaactattccaaattcatcctcttctaaagacgcatgggtgctattt
atttctatcaatcctggtgctcctcaagggggatcctatgtagagtattttattggtgac
ttcaatggtacagtatttaccccattcagtagggaaacacaagctttagatgatggtaaa
gattattatgcattccaaacattcttcaattctcctgacaattctactttgggtgttgct
tgggcatcaaattggcaatacggtcaatatgttccaacctatccttggagatcatcaatg
tcgttggtgagaaatttaacattagaatatttccaagctaacccagaatccaaaattcta
aaacttaaatcccaaccagttattgattatgattgtttcacttctaattcagacgtcatt
aaattttcaaacttgtcatctttatctactttggattctatttattcattctcaaattcc
agtgaaggcatactcgaatttaatctaacttggtcagttaacagctcgagttatgataat
catgattttgctgatttatcattaaaattaagaggtggtttaaatccatttgagtattta
agattaggatatttggctaatgtaaacagtttctttattgatcgaggccattctactaac
aattgggtcaatgaaaacccattctataccaataagctttcagttaatttacaaccgttt
gattatgttaatgacgaaatcagtacatataaagtatatggtataatcgatagaaacatt
atggagttatactttaatgatggttttcaagtttcgacaaataccttcttttttggagat
tacaactatatttcatctgtagaattgagcgttggaaaagatggagtatttgatattcaa
gagttcagtgtaagacaactacatttgaaataa

DBGET integrated database retrieval system