KEGG   Vanderwaltozyma polyspora: Kpol_489p3Help
Entry
Kpol_489p3        CDS       T01049                                 

Definition
(RefSeq) hypothetical protein
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
vpo  Vanderwaltozyma polyspora
Pathway
vpo00052  Galactose metabolism
vpo00500  Starch and sucrose metabolism
vpo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vpo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    Kpol_489p3
   00500 Starch and sucrose metabolism
    Kpol_489p3
Enzymes [BR:vpo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     Kpol_489p3
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C
Motif
Other DBs
NCBI-GeneID: 5543722
NCBI-ProteinID: XP_001643480
UniProt: A7TQ17
AA seq 602 aa AA seqDB search
MRTSSVAKSATLVAASLSLANAASSVTTTTLTANSASVTPFVGSDITTTWPSTIFSDLYT
SVDNETYGGFEESRPLIHATPPKGWMNDPNGLWYDASEELYHMYYQYSPNETYWSLPIVW
GHKTSKNLTVWDDAGIAMAPTDNTTGFYSGSVVVDYNNTSGFFNSTTDPRQRAVAIFTYN
TPEAEVQCVAYSLDGGYTFIQYESNPVLSNNSTQFRDPKVIWHEESQKWIMTIAKTQEYK
VSIYSSSDLKDWTLESEVEKVGVLGYQYECPGLARISLPNVTLASGSSNMTVPYPSTYSN
GTATPTDAWVMFISVNPGAPNGGSFVQYFIGDFNGTTFTPFTEQTQTLDDGEDYYALQTF
FNSADNSTLGVAWASNWKYAQSVDTYPWKSSMSLVRKFTLDYFQANPESKILSLKSEPCV
DYDVFDLNAGTLYTLNNATDDFMHAKITTNSSQGLLEFNMTWSVNASAYDNSEAADLSLY
LRGNQFDDEYLWLGYIANAGAFYLDRGNTGSPFTATCPLFNTRTAVNVQPCEYVSDEITT
YKVRGIVDRNIIELYFNDGAQVSTNTFFFMDGDYIETCELKVNKMGVFSIDEFSFRQLAL
KK
NT seq 1809 nt NT seq  +upstreamnt  +downstreamnt
atgagaacttcatcagttgcaaagtcagctactttagttgccgcttctttatctttggcc
aatgctgcctcatctgtcaccactaccactttaactgctaacagtgctagtgtcactcca
tttgtcggttcagatatcaccactacctggccatcaactatcttcagtgacttgtacacc
tctgttgacaacgaaacttacggtggtttcgaagaaagcagaccattgatccatgctacc
ccaccaaagggttggatgaacgatccaaacggtctatggtacgatgccagtgaagaactt
taccacatgtactaccaatacagtccaaatgaaacttactggtccttgccaattgtctgg
ggtcacaagacttctaaaaacttgactgtttgggatgacgctggtattgccatggctcca
actgataacactactggtttctactctggttccgttgttgttgattacaacaacacctct
ggtttcttcaattctactactgatccaagacaaagagctgtcgctatcttcacttacaac
actccagaagctgaagttcaatgtgtcgcttactctttagatggtggttacactttcatc
caatacgaatccaacccagtcttgtctaacaactctactcaattcagagatccaaaggtt
atctggcatgaagaatcccaaaagtggattatgactattgccaagactcaagaatacaag
gtttctatctactcttcttctgacttgaaggactggactttagaatctgaagttgaaaag
gttggtgttttgggttaccaatatgaatgcccaggtttggctagaatttccttaccaaac
gtcactttagcttctggttcctccaacatgactgtcccatacccatctacttattctaac
ggtaccgccactccaactgatgcttgggttatgttcatctctgtcaacccaggtgctcca
aacggtggttcttttgtccaatacttcattggtgacttcaacggtactactttcactcca
ttcactgaacaaacccaaactttggatgatggtgaagattactacgctttacaaactttc
ttcaactctgctgacaactctaccttaggtgttgcttgggcttccaactggaaatacgct
caaagtgtcgacacttacccatggaagtcatctatgtctttagttagaaagttcactttg
gactacttccaagctaacccagaatccaagatcttaagtttgaaatctgaaccttgtgtt
gattacgatgtctttgacttgaatgctggtactttgtacactttgaacaacgctaccgac
gacttcatgcatgctaagattaccaccaactcttctcaaggtttgttagaattcaacatg
acctggtctgtcaatgcttctgcttatgacaattccgaagctgctgatttatccttatac
ttaagaggtaaccaatttgatgatgaatacttgtggttaggttacattgctaatgctggt
gccttctacttggaccgtggtaacactggtagtccattcacagctacctgtccattattc
aacactagaactgctgtcaatgttcaaccatgcgaatatgtctctgacgaaatcactacc
tacaaggtccgtggtattgttgacagaaacatcattgaattatatttcaacgatggtgct
caagtttctaccaacactttcttcttcatggatggtgattacattgaaacttgtgaatta
aaggttaacaagatgggtgttttcagcatcgatgaattctccttcagacaattagccttg
aagaaatag

DBGET integrated database retrieval system