KEGG   Vanderwaltozyma polyspora: Kpol_543p69Help
Entry
Kpol_543p69       CDS       T01049                                 

Definition
(RefSeq) hypothetical protein
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
vpo  Vanderwaltozyma polyspora
Pathway
vpo00010  Glycolysis / Gluconeogenesis
vpo00260  Glycine, serine and threonine metabolism
vpo00680  Methane metabolism
vpo01100  Metabolic pathways
vpo01110  Biosynthesis of secondary metabolites
vpo01130  Biosynthesis of antibiotics
vpo01200  Carbon metabolism
vpo01230  Biosynthesis of amino acids
Module
vpo_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
vpo_M00002  Glycolysis, core module involving three-carbon compounds
vpo_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:vpo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Kpol_543p69
  Energy metabolism
   00680 Methane metabolism
    Kpol_543p69
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Kpol_543p69
Enzymes [BR:vpo01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Kpol_543p69
Membrane trafficking [BR:vpo04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    Kpol_543p69
Exosome [BR:vpo04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Kpol_543p69
  Exosomal proteins of melanoma cells
   Kpol_543p69
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_1 Tnp_22_dsRBD
Motif
Other DBs
NCBI-GeneID: 5546514
NCBI-ProteinID: XP_001646097
UniProt: A7THS3
AA seq 247 aa AA seqDB search
MPKLILVRHGQSEWNEKNLFTGWVDVKLSAKGEQEAARAGQLLKEKNVHPDILYTSKLTR
AIQTANIALANADRVWIPVKRSWRLNERHYGALQGKDKAETLETYGEEKFNTWRRSFDVP
PPVIEADSPFSQKGDERYRDVDPNVLPQTESLALVIDRLLPYWQDVIAKDLLDGKTVMVA
AHGNSLRALVKHLEGISDADIAKLNIPTGIPLVFELDENLKPSKPSYYLDPEAAAAGAAA
VAAQGKK
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgccaaagttaattttagttagacacggtcaatccgaatggaacgaaaagaacttattc
accggttgggttgatgttaaattatctgccaagggtgaacaagaagccgctagagccggt
caattgttgaaggaaaagaatgtccacccagatatcttatacacctccaagttgaccaga
gctatccaaaccgctaacatcgctttggctaacgctgacagagtctggatcccagtcaag
agatcctggagattgaacgaaagacactacggtgctttacaaggtaaggacaaggctgaa
accttggaaacttacggtgaagaaaaattcaacacctggagaagatctttcgatgtccca
ccaccagtcatcgaagctgactctccattctctcaaaagggtgatgaaagatacagagac
gttgatccaaatgtcttaccacaaactgaatctttggctttagtcatcgacagattgttg
ccatactggcaagatgttatcgccaaggacttgttggatggtaagaccgttatggtcgcc
gcccacggtaactctttgagagccttggttaagcacttggaaggtatttccgatgctgac
attgctaagttgaacatcccaactggtatcccattagtcttcgaattagatgaaaacttg
aaaccatctaagccatcttactacttggacccagaagctgctgccgctggtgccgctgct
gttgccgctcaaggtaagaaataa

DBGET integrated database retrieval system