KEGG   Veillonella parvula: Vpar_0651Help
Entry
Vpar_0651         CDS       T01130                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
vpr  Veillonella parvula
Pathway
vpr00071  Fatty acid degradation
vpr00280  Valine, leucine and isoleucine degradation
vpr00310  Lysine degradation
vpr00362  Benzoate degradation
vpr00380  Tryptophan metabolism
vpr00620  Pyruvate metabolism
vpr00630  Glyoxylate and dicarboxylate metabolism
vpr00640  Propanoate metabolism
vpr00650  Butanoate metabolism
vpr00900  Terpenoid backbone biosynthesis
vpr01100  Metabolic pathways
vpr01110  Biosynthesis of secondary metabolites
vpr01120  Microbial metabolism in diverse environments
vpr01130  Biosynthesis of antibiotics
vpr01200  Carbon metabolism
vpr01212  Fatty acid metabolism
vpr02020  Two-component system
Brite
KEGG Orthology (KO) [BR:vpr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Vpar_0651
   00630 Glyoxylate and dicarboxylate metabolism
    Vpar_0651
   00640 Propanoate metabolism
    Vpar_0651
   00650 Butanoate metabolism
    Vpar_0651
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Vpar_0651
   00072 Synthesis and degradation of ketone bodies
    Vpar_0651
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Vpar_0651
   00310 Lysine degradation
    Vpar_0651
   00380 Tryptophan metabolism
    Vpar_0651
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Vpar_0651
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Vpar_0651
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Vpar_0651
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:vpr04147]
    Vpar_0651
Enzymes [BR:vpr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Vpar_0651
Exosome [BR:vpr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Vpar_0651
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ACZ24334
UniProt: D1BLS7
Position
786337..787443
Genome map
AA seq 368 aa AA seqDB search
MSVYIHGGLRSPIGVLNGQYKHMRPEILGSQVIDEIINRYTISHIDGIFCGNAVGTGGNL
GRLMGLMCNLPNSVPAITVDMQCASALMSIEMAYTHIVSGVMNAVIAGGIESSSLQPERV
YASGDDRKGTYKVAQFTPQNQSLLAMLEGAERTIHKHNVTKEDLYPHIIGSHQRASAALD
NPYLQSYIMPITIDGKRCIDECIRPTMNEKLLSRMKPLLGADSITNAGNACLTHDGAAFV
YLSNKKGPFKIHSVKPWAGNPQFSPEGALESTEAILKRTGLTMDDIDVVEWNEAFAIIDV
LFNKAYPNHIKKYNMLGGALAYGHPYGCSGAILVLHCMAALESCGGRYGLCAIAGAGGTG
TALIMERM
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgtcagtatatattcatggtgggcttagaagtcctatcggcgttttaaatggacaatat
aaacatatgagacccgagattttgggctctcaagtaattgatgaaataattaatcgttat
actatttcacatatagatggaatcttctgtggtaatgcggttggtactggtggtaacctt
ggccgtctcatggggcttatgtgtaatttaccaaattctgtgcctgctatcaccgttgat
atgcaatgtgcctcggcattaatgagtattgagatggcgtatacacatattgtgtcaggt
gttatgaatgctgtcattgcgggtggtattgaaagttcttcgttacagccagagcgggtg
tatgcatcaggggatgatcgaaaaggaacctataaggtagctcaatttacgccccaaaat
caatctcttttagccatgctcgaaggggctgagcggactatccataaacacaatgtaaca
aaggaggatttatatccacatattattggcagtcatcaaagagcatcagctgctttagat
aacccatatttacagtcatatattatgcctattactatagatggtaaaagatgtatagat
gaatgtattcgacctacgatgaacgagaaactcttgtctaggatgaagcctttgttggga
gctgactctattacaaatgcaggtaatgcgtgtttaactcatgatggagcggcctttgta
tatttatctaataaaaagggtccttttaaaattcatagcgttaaaccttgggcaggaaat
cctcagtttagtccggagggcgctcttgaaagtacagaagccattttaaaacgtacaggt
ttaactatggatgatattgatgtggtggaatggaatgaagcttttgccatcattgatgtt
ctttttaacaaggcgtaccctaatcacattaaaaaatataacatgcttggaggtgcctta
gcttatggacatccctatggatgttctggtgccatattagtgcttcactgtatggctgct
ttagaatcttgtggtggtcgttatggtttatgtgctattgctggtgcagggggcacaggt
acggctttaattatggaacgcatgtaa

DBGET integrated database retrieval system