KEGG   Veillonella parvula: Vpar_1289Help
Entry
Vpar_1289         CDS       T01130                                 

Definition
(GenBank) formate-tetrahydrofolate ligase FTHFS
  KO
K01938  formate--tetrahydrofolate ligase [EC:6.3.4.3]
Organism
vpr  Veillonella parvula
Pathway
vpr00670  One carbon pool by folate
vpr01100  Metabolic pathways
vpr01120  Microbial metabolism in diverse environments
vpr01200  Carbon metabolism
Module
vpr_M00140  C1-unit interconversion, prokaryotes
Brite
KEGG Orthology (KO) [BR:vpr00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    Vpar_1289
Enzymes [BR:vpr01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.3  formate---tetrahydrofolate ligase
     Vpar_1289
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FTHFS
Motif
Other DBs
NCBI-ProteinID: ACZ24969
UniProt: D1BNL2
Position
complement(1474202..1475872)
Genome map
AA seq 556 aa AA seqDB search
MLSDIEIAQQNTMEKIQVIADKCGLTPDDIEQYGHYKAKISFDAIRRLESKPDGKLVLVT
AITPTPAGEGKSTTSIGLVQGLQKIGKNAIATLREPSLGPVFGIKGGAAGGGYAQVVPMD
DINLHFTGDMHAITAANNLLSAMIDNHIHQGNELQIDLRQLSWTRVLDMNDRALRNVTVA
LGGKVCGFPREDHFMITVASEIMAILCLAKDLEDLKERFGRIVIGCNLAGDPVYVHQLGC
QGAMALLMKDAIKPNLVQTLEHTPAIVHGGPFANIAHGCNSIVATKLGLKLGDIVVTEAG
FGADLGAEKFLDIKCRYGDIFPDAIVIVATLRALKMHGGVPKQELNTENVEAVTKGFSNL
QKAIENMRYFNVPVLVAINKFASDTDAEIAELTRLCDEFGVPVELNECWEKGGEGGTDMA
KKVVELLEGPKPTPKFVYDLEDSLEDKVNKIVKTIYGGDGVIFTDKAKKQIKQLADWGLD
RLPVCMAKTQYSLSDNPALLGAPTGFTITVSDIRVANGAGFIVCRTGDVMVMPGLPKRPA
ALNMDIEADGTIKGLF
NT seq 1671 nt NT seq  +upstreamnt  +downstreamnt
atgttaagcgatattgagattgcccaacagaatacaatggagaagattcaggttattgcc
gataaatgtggtttaacacctgatgatattgaacaatatggtcattataaagcgaaaatt
tcctttgatgccattcgccgtttagaatctaagccagatggtaaattggtgttagtcaca
gcaatcacgccaacaccagccggggaaggtaagtctacaacgagcattggtctcgtacag
gggctacaaaaaatcggtaaaaatgcaattgctacattacgtgagccatccttaggacct
gtttttgggattaaaggtggtgcagcaggtggtggttatgctcaagttgtacctatggat
gacatcaaccttcactttacaggtgatatgcatgctattacagcggctaacaatttatta
tccgctatgatcgataaccatatccatcaaggtaatgaattgcaaatcgatttgcgtcaa
ctatcttggacacgtgttctagatatgaatgatcgtgctcttcgcaatgtgacagttgca
cttggtggcaaagtatgtggattccctcgggaagatcattttatgattaccgttgcttct
gaaatcatggctattctttgcttagctaaggatttagaagatttgaaagaacggtttggt
cgcatcgttatcggttgtaacttagcaggtgatcctgtttatgttcatcaacttggttgc
caaggggcaatggcgcttctcatgaaagatgctatcaagccaaatctcgtacaaacattg
gaacatacaccagccattgttcacggtggtccctttgcaaatatcgctcatggttgtaac
tccattgtagctacaaaactaggacttaagcttggtgatatcgtagttacggaagcgggc
tttggcgctgacttgggtgctgaaaagttccttgatattaaatgccgatacggcgatatt
ttccctgatgcaatcgttatcgtagctacattacgagctcttaaaatgcatggtggtgta
ccaaaacaagagttgaatacagaaaatgttgaagctgtaactaaaggtttcagcaactta
caaaaagcaattgaaaacatgcgttatttcaatgtgcctgtattagtggcaatcaataaa
tttgctagcgatacagatgcagaaattgctgagttgactcgcctatgtgatgagtttggc
gtgcctgtagagcttaatgaatgttgggaaaagggtggcgaaggcggcactgatatggca
aaaaaagtcgtagagttacttgaaggtcctaagccaacacctaaattcgtatatgatttg
gaagatagtttagaggataaagttaataaaatcgttaaaactatttatggtggcgatgga
gttatctttacggacaaagccaaaaagcaaattaaacaattagcagattggggactggat
cgtttgcctgtatgtatggcgaaaacgcaatattccttatctgataatccagcattatta
ggggctccaacaggattcactattactgtatccgatattcgtgttgccaatggggcaggc
tttattgtatgtcgtacaggtgatgtaatggtaatgccaggccttcctaaacgtcctgct
gctcttaatatggatattgaagcagacggcacaattaaaggcttattttaa

DBGET integrated database retrieval system