KEGG   Veillonella parvula: Vpar_1353Help
Entry
Vpar_1353         CDS       T01130                                 

Definition
(GenBank) phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
vpr  Veillonella parvula
Brite
KEGG Orthology (KO) [BR:vpr00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    Vpar_1353
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: ACZ25031
UniProt: D1BNS4
Position
complement(1545248..1546246)
Genome map
AA seq 332 aa AA seqDB search
MLDAHYLVWLVVFLALAFDYINGFHDTANAIATSVSTRAIEPKKAIMMTAALNFLGAMVS
TGVAKTIGGDIVMSPSLIDSGIISAALIGAITWNLLTWYWGIPSSSSHALIGGIIGAVGW
SVGFDALNEAGILKIFLSLILSPIVAMIGGYIVMKILLLIFGRFSPIVLNDRFRSMQIVS
AIMMAFSHGSNDAQKAMGIITLTLLSGGFIDTLDVPIWVKLCCATAMAMGTAVGGWKIIS
TMGTKIFKLETINGFAADLNSAITIFTATFLHLPVSTTHVVSGSLLGVGSSKRIKAVNWG
VARSMVMAWFVTIPLSGIVAAIAYEVGHLLFG
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgcttgatgctcattatttagtatggctagttgtatttttagcattagcttttgactat
atcaatggctttcatgatacggcaaatgccattgccacatctgtttctacacgagctatt
gagcctaaaaaagcgattatgatgaccgctgctctcaattttttgggtgcaatggttagt
acaggtgttgcaaagactatcggtggtgatatagtaatgtcgccatcccttatcgatagt
ggtattatttctgcagcccttatcggtgccatcacatggaatcttttaacctggtattgg
ggaatcccaagttcctcatcccatgctttgattggtggtatcattggtgctgtgggctgg
tctgtaggatttgacgctttgaatgaggcggggattttaaaaatctttttgtctcttatt
ttatctccgattgtagccatgattggtggctacattgtgatgaagatattgttgcttatt
ttcggtagattttctccaattgttttgaatgatcgatttagatccatgcaaattgtatca
gcaattatgatggcattttctcatggctctaatgatgcacaaaaagcgatggggataatc
acattaaccttacttagcggtggtttcatcgatacattagatgtaccgatttgggtaaaa
ctttgttgtgctactgcaatggctatgggtactgctgtaggcggttggaaaattatctct
acaatgggaactaagattttcaaactagaaactattaatgggtttgcagctgatctaaat
tctgctattacaatttttacagctacatttttacatttgcctgtaagtactacacacgta
gtaagtggttctttactaggtgtaggctcttctaaacgtattaaagcagtcaactggggt
gtagcaagatctatggttatggcttggtttgtaacgattccattatctggtatcgttgcc
gctattgcttatgaagtaggtcacttactatttggctaa

DBGET integrated database retrieval system