KEGG   Veillonella parvula: Vpar_1773Help
Entry
Vpar_1773         CDS       T01130                                 

Definition
(GenBank) glycoside hydrolase family 3 domain protein
  KO
K01207  beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
vpr  Veillonella parvula
Pathway
vpr00520  Amino sugar and nucleotide sugar metabolism
vpr01100  Metabolic pathways
vpr01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:vpr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Vpar_1773
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    Vpar_1773
Enzymes [BR:vpr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Vpar_1773
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_3
Motif
Other DBs
NCBI-ProteinID: ACZ25449
UniProt: D1BPZ2
Position
complement(2031052..2032197)
Genome map
AA seq 381 aa AA seqDB search
MFRRFVAATMIGALALTTGCGLHNPFTSKAEPVTYESVAQSELSPEQKVDKLVANMSDAD
KVGQLLMIGIHGTTLNDDAKFMLNEYRVGGIILFDRNMESKDQVKTLITDINKAGKSAGL
TPLFLGIDQEGGAVARMDDKLIKVPPAEEVGKMPVEQAVSLAKQSGAELKDLGFNINFAP
VADLGLTYGRSYSTSPDEVVRYAGAVGKAYDEAGLWYSYKHFPGIGKTDVDLHADTSIVP
VSKETLLSEDTKVFIDLIKQSKPNTYTIMVSHAMYPQIDPDHPASLSKAIITDWLRKDIG
YNGVVVTDDMDMGALAKHYTFGDMAVQSILAGSDILLVCHEYEHMQEAYNGLMKAVKDGR
ISKERLDESVKRILLMKMSKI
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgtttcgacgtttcgtagcagccactatgattggtgcattagcactcacaacaggctgc
ggtttacataatccatttacttcaaaggcagagcctgtgacctatgagtctgtggcacaa
agcgaactttcaccagagcaaaaggtggacaagttagtggcgaatatgtccgatgcagac
aaggtgggtcaattgttgatgattggcattcacggaacaacgctaaacgatgacgctaaa
tttatgctcaacgagtaccgtgtgggcggtatcatcttgttcgaccgtaacatggagtcc
aaggatcaagttaaaacgctcattacagatattaacaaggccggtaaaagcgcgggttta
acgccattgttcctcggtatcgaccaggagggcggtgcggtagcgcgcatggatgataag
ctcatcaaggttcctcccgctgaggaggtaggcaaaatgcccgttgagcaagctgtatcc
ttggcaaaacagtctggtgcagaactaaaagacttgggattcaatattaattttgctcct
gtggcggatttgggattaacttatggtcgttcttatagtacgagtcctgacgaggtcgtt
cgctatgcaggcgccgttggcaaggcttatgatgaagcgggcttatggtattcttataag
cactttccgggtattggtaagactgatgtagacttgcacgcggacacaagtatcgttcct
gtatctaaagaaacattgctttcagaggacacaaaggtatttatagaccttatcaaacag
tctaaaccgaatacctatacaatcatggtgtctcatgcgatgtacccacaaatcgatcca
gatcatcctgctagtttatcgaaagcgattattacggattggttgcgcaaggacataggc
tataatggcgttgtcgtaacggacgatatggacatgggtgccctcgcaaaacactatact
tttggtgatatggcagtgcaatccatcctcgcaggtagcgacatcttgctcgtatgtcac
gaatacgaacacatgcaagaggcttacaatggccttatgaaagccgtgaaagacggtcgc
atctcgaaagaacgactcgatgaatcggtgaaacgaatcttgcttatgaaaatgagcaaa
atttag

DBGET integrated database retrieval system