KEGG   Vibrio qinghaiensis: CCZ37_02720Help
Entry
CCZ37_02720       CDS       T05259                                 

Gene name
hemL
Definition
(GenBank) glutamate-1-semialdehyde-2,1-aminomutase
  KO
K01845  glutamate-1-semialdehyde 2,1-aminomutase [EC:5.4.3.8]
Organism
vqi  Vibrio qinghaiensis
Pathway
vqi00860  Porphyrin and chlorophyll metabolism
vqi01100  Metabolic pathways
vqi01110  Biosynthesis of secondary metabolites
vqi01120  Microbial metabolism in diverse environments
Module
vqi_M00121  Heme biosynthesis, plants and bacteria, glutamate => heme
vqi_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:vqi00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CCZ37_02720 (hemL)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:vqi01007]
    CCZ37_02720 (hemL)
Enzymes [BR:vqi01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.8  glutamate-1-semialdehyde 2,1-aminomutase
     CCZ37_02720 (hemL)
Amino acid related enzymes [BR:vqi01007]
 Aminotransferase (transaminase)
  Class III
   CCZ37_02720 (hemL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: ASU21571
UniProt: A0A223MVJ1
Position
1:complement(555071..556366)
Genome map
AA seq 431 aa AA seqDB search
MTKSAELYQKAQRAIPGGVNSPVRAFNGVGGSPIFIDRADGPLIFDADGKAYIDYVGSWG
PMILGHNHAVIREAVIGAAQRGLSFGAPTEMEIDMAELVSELVPSMEQLRMVSSGTEATM
SAIRLARGFTGRDKILKFEGCYHGHADSLLVKAGSGALTLGQPSSPGVPADFAKHTLTAT
FNDLESVRELFAANKGQIACIIVEPVAGNMNCIPPVEGFHEGLRDICDQEGALLIFDEVM
TGFRVALGGAQAYYNIKPDLTTLGKVIGGGMPVGAFGGRRDVMQYIAPTGPVYQAGTLSG
NPVAMAAGYACLTLLKEEGNEKRLAAKTKQLADGFKELADKHGIPLLVNQVGGMFGFFFT
DQERVTCYEEVVKCDVERFKRFFHLMLEHGVYLAPSAFEASFTSLAHGSKEIEATLEAAD
RCFAMMAAQAG
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaatcagcagagctttatcaaaaggcacaacgtgcaattcccggtggagtgaac
tctcctgtacgtgcttttaacggagttggtggctcgccgatttttatcgaccgcgcagac
ggcccgttgatttttgatgctgatggcaaagcttatattgattatgtcggctcttggggg
ccaatgatacttggccataatcatgcggttattcgtgaagctgtgataggcgctgcgcag
cgtggtctcagttttggtgcgccgaccgagatggaaatcgatatggcggagttggtttct
gagctggttccatcgatggaacaactacgcatggtcagttccggtaccgaagcgacgatg
agcgccattcgtttagctcgtggattcactggccgcgataaaattttaaaatttgaaggc
tgctatcacggtcatgcagacagcttgctagtgaaagcaggctctggcgccttaacgtta
ggtcaaccaagctctcctggtgtgcctgctgattttgctaaacatacactgaccgccact
tttaatgatttagaatctgtacgcgaattgttcgcggccaataaaggccaaatagcctgt
attatcgttgaaccggtcgcgggcaacatgaactgcattccaccagttgaagggttccat
gaaggcttgcgtgacatctgtgaccaagaaggtgctctgctgatctttgatgaagtaatg
acaggatttcgtgttgcactaggtggtgcacaggcttactacaacatcaaaccagactta
acaacactggggaaagtgattggcggtggtatgcctgttggcgcttttggtggacgccgt
gatgtgatgcaatacatcgctccaacgggtccggtgtaccaagctggtacgctatcaggt
aaccctgtggctatggctgcgggttatgcttgcttgacgcttctaaaagaagaaggcaat
gaaaaacgtctcgcggccaaaacaaagcaattggctgatggattcaaagaacttgcagac
aaacacggtattcctttgctggtgaaccaagttggtggcatgttcggcttcttttttacc
gatcaagagcgcgtcacctgttatgaagaagtcgtaaaatgtgatgttgaacgtttcaag
cgcttcttccacttgatgcttgagcatggtgtctatttagcaccttcagcttttgaagca
agctttacctctttggctcacggctctaaagagattgaagcaacactagaagcagccgat
cgctgttttgcgatgatggcagctcaagcgggataa

DBGET integrated database retrieval system