KEGG   Vibrio qinghaiensis: CCZ37_09045Help
Entry
CCZ37_09045       CDS       T05259                                 

Definition
(GenBank) succinate--CoA ligase subunit beta
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
vqi  Vibrio qinghaiensis
Pathway
vqi00020  Citrate cycle (TCA cycle)
vqi00640  Propanoate metabolism
vqi00660  C5-Branched dibasic acid metabolism
vqi01100  Metabolic pathways
vqi01110  Biosynthesis of secondary metabolites
vqi01120  Microbial metabolism in diverse environments
vqi01130  Biosynthesis of antibiotics
vqi01200  Carbon metabolism
Module
vqi_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:vqi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CCZ37_09045
   00640 Propanoate metabolism
    CCZ37_09045
   00660 C5-Branched dibasic acid metabolism
    CCZ37_09045
Enzymes [BR:vqi01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     CCZ37_09045
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5
Motif
Other DBs
NCBI-ProteinID: ASU22730
UniProt: A0A223MYV0
Position
1:complement(1974952..1976118)
Genome map
AA seq 388 aa AA seqDB search
MNLHEYQAKQLFAEFGLPVPEGYACDTPQEAFEAAGRISTAKKVVKCQVHAGGRGKAGGV
ELHDTKDGVKEFAQKWLGKNLVTYQTDANGQPVSKILVEEASNIANELYLGAVVDRATRR
VVFMASTEGGVEIEKVAEETPELIHKAAIDPLVGPQAYQGRELAFKLGLEGDQIKQFVKI
FLGLGAMFTRYDLALLEINPLVVTAEGNLLCLDGKINIDSNALYRQPKLREMHDSSQEDE
REAHAAQWELNYVALDGNVGCMVNGAGLAMGTMDIVNLHGGKPANFLDVGGGATKERVAE
AFKIILSDHNVKAVLVNIFGGIVRCDMIAEGIIGAVKEVGVTVPVVVRLEGTNAELGRGV
LANSGLDIIAAESLTDAAQKVVAAAEGK
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaatttgcatgaatatcaagccaaacagctgtttgcagaattcggtttgcctgtaccg
gaaggttatgcctgtgatactccacaagaagcttttgaagcggcgggtcggattagtaca
gcgaagaaagttgttaagtgtcaagtgcatgcaggtggtcgcggtaaagcgggtggcgtt
gagttgcacgacactaaagatggtgtcaaagagtttgctcaaaaatggctaggtaaaaat
ctggttacttatcaaacggacgcaaatggtcagccagtatcaaaaattttggtcgaagaa
gcctctaatatcgcgaatgagctttacctaggcgcagtcgtcgatcgtgcgactcgtcgt
gtcgtgtttatggcctcaacagaaggcggcgtggaaattgaaaaagtagcggaggagact
cctgagctgattcataaagccgcgattgatcctttggttggtccgcaagcctatcaaggt
cgcgaacttgctttcaaacttggcttggaaggcgaccaaattaagcaatttgtgaaaatc
ttccttggccttggtgctatgtttacccggtatgatcttgcactgctagaaattaaccct
ttggttgttaccgctgaagggaacttgttatgccttgatggcaaaatcaacatcgactca
aacgcactttatcgccaacctaaacttcgtgaaatgcatgactcatcgcaagaagatgag
cgcgaagctcatgctgctcagtgggaactgaactatgttgctcttgatggcaatgttggc
tgcatggtgaacggtgctggtcttgcaatgggtactatggatattgttaaccttcatggc
ggcaaacctgcaaacttccttgatgttggtggtggcgcgaccaaagagcgtgttgctgaa
gcgttcaaaatcattttatctgatcacaacgtgaaagccgtattggtgaatattttcggc
ggtatcgtacgttgcgatatgattgcagaaggcattatcggcgcggtgaaagaagttggt
gtaacggttcccgttgtcgtgcgtttggaaggtacaaatgcggaattaggacgcggagta
cttgcaaattctggtcttgatatcattgcagctgagtcgttaacggacgcagctcagaaa
gttgttgctgcggcggagggtaaataa

DBGET integrated database retrieval system