KEGG   Vibrio qinghaiensis: CCZ37_18235Help
Entry
CCZ37_18235       CDS       T05259                                 

Definition
(GenBank) adenylosuccinate synthetase
  KO
K01939  adenylosuccinate synthase [EC:6.3.4.4]
Organism
vqi  Vibrio qinghaiensis
Pathway
vqi00230  Purine metabolism
vqi00250  Alanine, aspartate and glutamate metabolism
vqi01100  Metabolic pathways
Module
vqi_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:vqi00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    CCZ37_18235
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CCZ37_18235
Enzymes [BR:vqi01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.4  adenylosuccinate synthase
     CCZ37_18235
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Adenylsucc_synt
Motif
Other DBs
NCBI-ProteinID: ASU24381
UniProt: A0A223N3I0
Position
2:1017524..1018834
Genome map
AA seq 436 aa AA seqDB search
MFKAIVGLQFGDEGKGKFVDLLSQHYQHVARFNGGANAGHSVVVNGQRSAFSQLPATRSD
GKCLYVCQGALISLEKLVQEIEFMTITCPHSKIFIDPRCHIVLTIHAQLNQASERYKGTK
KIGSVGVGVGACFEDKSNRLGIRLEDTLDKPVLRRKLELLWKIRTKQIEAVFEGELTLCF
EQEVERLLELGQKLKPYFHFTNQAIAELLKEGHDILLESSQATYLDNSFGTYPYTVAYST
LIQSCFAYIGIPADKLNVLGVMKSYMIRVGNGPFPTEINGDIAQYIRVRGREYGTVSQRP
RRCGWLDLALIEHAIRLNGVNEVAITNIDVLAGMDEIWICTGYTLHGQTVCTDKALLHFD
QVKPSYTKLDSWPQLPNEELQSFDFHENLIKYLTFIQSRISAPIRYISYGADRNQTIQLD
HHGVTQAFTQSLEQCA
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgtttaaagccattgtaggacttcagttcggcgatgaaggaaaaggtaagtttgtcgat
ttattatctcaacattatcagcatgttgccagatttaatggcggagccaatgccggacat
tctgtagtagtcaacggccagcgatctgcattttctcaactaccagcaacccgatccgat
ggtaaatgtctgtatgtctgccaaggtgcgcttatcagtttagaaaaattagtacaagaa
attgaatttatgacgatcacttgtccacatagcaagatttttatcgatcctcgttgccac
attgtacttactatccatgctcagcttaaccaagcgtcagaaaggtacaaaggtactaag
aagataggctctgttggcgttggtgttggtgcctgtttcgaagataaatcaaatcgtttg
ggtattcgactggaggatactcttgataagccagtgctacgtcgaaaactcgaactcctc
tggaaaattagaactaagcaaattgaagcggtgtttgaaggtgaattaacactctgtttt
gagcaagaagtggaacgtctactagaattaggtcaaaaattaaaaccttatttccatttt
acgaaccaagcgattgcagagctccttaaagaagggcatgacatattattagagtcttct
caagccacataccttgataacagtttcggaacctatccttatactgttgcctattcaaca
ttaattcaaagctgctttgcttatattggtattcccgctgataaactcaatgtattgggt
gtaatgaaatcctatatgattcgtgtaggtaatggccccttccctactgaaattaatggc
gatatcgcccagtatattcgcgtgagaggtcgtgaatatggcacagtgtctcaacgccct
agacgttgtggctggttagaccttgcactgattgagcatgctatccgtttaaatggcgtc
aatgaagtagcaattaccaatatcgatgttcttgctggaatggacgaaatttggatttgt
acaggttatacattacatggtcaaacagtctgcaccgacaaagccttattgcattttgat
caagtaaaaccaagctataccaaattagacagttggcctcaactacctaatgaagaattg
caatcttttgattttcatgaaaatttaattaagtaccttacatttattcagtcacggatc
agtgctcctattcgatatatctcttacggtgctgaccgtaatcaaacgatccaattagac
caccatggggttacgcaggctttcactcaaagtttggaacaatgtgcatga

DBGET integrated database retrieval system