KEGG   Vigna radiata (mung bean): 106754109Help
Entry
106754109         CDS       T04126                                 

Definition
(RefSeq) probable serine/threonine-protein kinase WNK9 isoform X1
  KO
K08867  WNK lysine deficient protein kinase [EC:2.7.11.1]
Organism
vra  Vigna radiata (mung bean)
Brite
KEGG Orthology (KO) [BR:vra00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:vra01001]
    106754109
   01009 Protein phosphatases and associated proteins [BR:vra01009]
    106754109
Enzymes [BR:vra01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     106754109
Protein kinases [BR:vra01001]
 Serine/threonine kinases: Other
  Wnk family
   106754109
Protein phosphatases and associated proteins [BR:vra01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     106754109
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr OSR1_C Pkinase_fungal
Motif
Other DBs
NCBI-GeneID: 106754109
NCBI-ProteinID: XP_022633509
UniProt: A0A1S3TCR2
Position
Unknown
AA seq 730 aa AA seqDB search
MNGAACVDAECCEFVEVDPTGRYGRYNEILGKGASKTVYRAFDEYEGIEVAWNQVKLYDF
LQNPEDLERLYSEIHLLKTLKHKNIMKFYTSWVDTANRQINFVTEMFTSGTLRQYRLRHR
RVNIRAVKHWCRQILEGLLYLHSHNPPVIHRDLKCDNIFINGNQGEVKIGDLGLAAILRK
SNAARCVGTPEFMAPEVYEEDYNELVDIYSFGMCILEMVTFEYPYSECNHPAQIYKKVVS
GKKPEALYKVDSPEVRQFVEKCLATASLRLSAKELLEDPFLQIDDFGFDSKVFQYQRDCY
EVAPLIRQPLNGTYSINTSMSGYTDNLGGYGPFSELDYHQNDFETREIGLFDCEDDDNLA
KVDTTIKSGRREDDGIFLRLRIADNEGRIRNIYFPFDIETDTALSVANEMVTELDITDQD
VADLANMIDNEIATLVPEWRTGVRIEENSECSGAGVCLNCAANGYLVDYVSSNNPCGKNL
QFLHCSKNGCAAIHGRFEEITYQVEGSASSDAEGARDASSHPDGIHYTDIWAQRDEPELC
HEELKDIHCDQTHEASNPLNIKEEGKAVNVDEKSYLNTKRPHSNPAINCVMLDCENEIRQ
ELRWLKAKYQMQLRELRDQQLGVKPKFTCMSPDTKKLNCGKDGIQSLSAQSRLKIQKHKP
QLRSIVSGKHFPLEDEKCNNYADQMVQNVEEINQSNSPERMLTAKDFFTGALFPNSLQRA
TSLPVDAIDF
NT seq 2193 nt NT seq  +upstreamnt  +downstreamnt
atgaatggtgctgcatgtgttgatgcagagtgctgtgagtttgtggaagttgatcctaca
ggaagatatggaagatacaatgaaattcttggcaaaggagcttccaagacagtctataga
gcatttgatgagtatgaagggatagaagtagcatggaatcaagtaaagctttatgacttt
ttgcagaatcctgaagatcttgagaggttatacagtgaaatccatcttctcaagacattg
aaacacaagaacatcatgaagttctatacttcgtgggttgatactgccaacagacaaatc
aattttgtcactgagatgtttacctctgggactctaagacagtacagacttaggcacaga
cgggttaacatcagagctgttaagcattggtgtaggcagattttggaagggcttctgtat
ctgcacagccataatcctcctgtgatccacagagatctcaagtgtgataacattttcatc
aatggcaaccaaggggaagtcaaaatcggtgatcttggccttgctgcgattctccgaaaa
tctaatgctgcccgttgtgttggcacccctgagtttatggctccggaagtgtatgaagag
gattacaatgagttggttgacatatactcttttggaatgtgcatcttagagatggtcact
tttgaatatccttatagtgaatgcaaccatcctgctcaaatttacaagaaagttgtatct
gggaagaagccagaagctctttacaaagtagacagtccagaggtaagacagtttgtagag
aaatgcttagcaaccgcgtccctcagactttcagctaaggaactcttggaggaccctttt
ctgcaaattgatgattttggatttgactcaaaagtattccagtatcaaagagattgctat
gaagtggccccattaatcagacagcctttgaatggaacgtatagcatcaacacctcaatg
agtgggtacactgataatcttggtggttatgggcccttctctgaattggattatcatcaa
aacgatttcgaaacaagggaaatcggtctctttgattgtgaagacgatgacaatttagct
aaggttgacaccacaatcaaaagtgggagaagagaagatgatggcatctttttgagactc
agaattgcagataatgaaggtcgaattcgaaacatctacttcccattcgacattgagact
gatactgcattgagcgttgcaaatgaaatggtaactgagcttgacataactgatcaagat
gtagcagatttggcaaatatgatagacaatgaaattgcaacattggttcccgagtggaga
acaggagtcagaatagaggaaaattcagaatgttcaggtgcaggtgtctgcctcaattgt
gctgcaaacggctacttggttgattatgtatcatcaaataatccatgtggcaagaatctt
caatttctccattgttctaaaaatggatgtgctgcaattcatggccgatttgaggagata
acataccaagttgaagggtctgcaagtagtgatgccgaaggtgcacgggatgcatcaagc
catcccgatggcattcattatacagatatttgggcccagagagatgaaccagagttatgc
catgaagagttaaaagacatacactgtgaccaaactcatgaggcatcaaatccattgaac
atcaaggaggaaggaaaagctgttaatgtggatgaaaaaagttatctcaataccaaaagg
cctcattcaaaccctgcaataaattgtgttatgttggattgtgaaaatgaaatcaggcaa
gagctaagatggctcaaagcaaagtaccagatgcagttaagggagcttagagatcaacaa
ctgggggttaagccaaaatttacttgcatgtctcctgatacgaaaaaattaaattgtggg
aaagatggaattcagagtttatcggctcaatccagattgaagatacaaaagcataaacca
caattaagatctatagtttctgggaagcattttcctcttgaagacgagaaatgcaacaat
tatgctgatcaaatggttcaaaatgttgaggagattaatcagtctaacagtcctgagcga
atgctcacagccaaggatttctttacaggagctttgtttccaaactcacttcagagggca
acctcccttcccgttgatgcaatagatttctag

DBGET integrated database retrieval system