KEGG   Vigna radiata (mung bean): 106756693Help
Entry
106756693         CDS       T04126                                 

Definition
(RefSeq) tyrosine decarboxylase 1
  KO
K01593  aromatic-L-amino-acid/L-tryptophan decarboxylase [EC:4.1.1.28 4.1.1.105]
Organism
vra  Vigna radiata (mung bean)
Pathway
vra00350  Tyrosine metabolism
vra00360  Phenylalanine metabolism
vra00380  Tryptophan metabolism
vra00950  Isoquinoline alkaloid biosynthesis
vra00965  Betalain biosynthesis
vra01100  Metabolic pathways
vra01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:vra00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    106756693
   00360 Phenylalanine metabolism
    106756693
   00380 Tryptophan metabolism
    106756693
  09110 Biosynthesis of other secondary metabolites
   00901 Indole alkaloid biosynthesis
    106756693
   00950 Isoquinoline alkaloid biosynthesis
    106756693
   00965 Betalain biosynthesis
    106756693
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:vra04147]
    106756693
Enzymes [BR:vra01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.28  aromatic-L-amino-acid decarboxylase
     106756693
    4.1.1.105  L-tryptophan decarboxylase
     106756693
Exosome [BR:vra04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   106756693
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_1_2
Motif
Other DBs
NCBI-GeneID: 106756693
NCBI-ProteinID: XP_014494710
UniProt: A0A1S3TLS7
Position
3
AA seq 491 aa AA seqDB search
MEENDALRAMDAEQLREHAHKMVDFIADYYKTIQNFPVLSQVQPGYLGKLLPDSAPEYPE
SLQNVLDDVKEKILPGVTHWQSPNYFAYFPSNSSIAGFLGEMLSAGLNIVGFSWITSPAA
TELESIVLDWLAKAFQLPEDFYSSGKGGGVIQGTASEAVLVVLLAARDKILRRLGRSALP
KLVMYASDQTHSALRKACQIAGLNPELCKLLKADSATNYALSPEVLSEAISNDIAGGLVP
FFLCATVGTTSSTAIDPLPALGKIAKTNNLWFHVDAAYAGSACICPEYRHCFDGIEESDS
FNMNAHKWFLTNFDCSVLWVKDRSSLIQSLSTNPEFLKNKASQGNLVIDYKDWQIPLGRR
FRSLKLWMVLRLYGLEGLRSHVRNHIELAAYFEELVSQDTRFKVVVPRTFSLVCFRLLPP
LNSEDHGNKLNSDLLDSVNSTGNIFISHTVLSGEYILRFAVGAPLTERRHVTTAWQIFQE
KATALLESLQD
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atggaagagaatgatgcattgagggccatggacgctgagcaactgagagagcacgctcat
aagatggtcgatttcattgctgattactacaaaaccattcaaaacttccccgttctaagc
caagtccagccaggttatctggggaagcttttaccagattctgctcccgagtatcctgag
tccttgcaaaatgtgttggacgatgtaaaggagaaaatactcccaggggtgacgcattgg
caaagtccgaattattttgcgtattttccttccaacagtagcattgctggatttcttgga
gagatgctcagtgcgggacttaacattgtgggtttcagctggataacttctcctgctgcc
actgaacttgaaagcattgttcttgactggctggctaaggcgttccagttgcctgaagat
ttctattctagcggaaaaggtggtggagttatacagggaacagcaagtgaagctgtacta
gttgtcctattagctgcacgtgacaagatcttaagaaggcttggaaggagtgcccttcct
aagcttgtgatgtatgcatctgatcaaacacactctgctttacgaaaagcttgtcagata
gcaggacttaatccagagctttgcaagttgcttaaagctgattctgcaacaaattatgca
ctctctcctgaagtactttctgaagcaatttcaaatgacattgctggcggtcttgtaccc
tttttcttatgtgctactgttggcaccacttcgtcaacagctattgatcccctgcctgca
ttgggaaaaattgccaagaccaacaatctttggtttcacgtggatgctgcttatgctggc
agtgcttgtatatgtccagagtaccgccactgctttgacggtattgaagaaagtgactca
tttaacatgaatgcacataaatggttcctcaccaactttgactgttcagtactatgggtt
aaggacagaagttctctgattcaatcactgtctacaaatcctgaatttctgaaaaacaag
gcctctcaaggaaacctggtcatagattacaaagattggcaaattcctcttggtcgtcgc
tttagatcattaaaattgtggatggtgttgcgactttatggtttggaaggtctgcgaagt
cacgtaagaaaccacattgagttagctgcttattttgaagagcttgttagtcaggacaca
agattcaaggtcgttgtacctcgtacattctccttagtttgctttcggctattgccccct
ctcaattctgaagatcatggtaataaactaaatagcgatctactcgactcagtaaattca
acaggaaatattttcatatcacacacggttctatcaggtgagtacattctacgttttgca
gtaggagcaccattgacagaaaggaggcatgtcactactgcgtggcagatttttcaagag
aaagccactgctctacttgagagtttacaggattaa

DBGET integrated database retrieval system