KEGG   Vigna radiata (mung bean): 106756883Help
Entry
106756883         CDS       T04126                                 

Definition
(RefSeq) heterodimeric geranylgeranyl pyrophosphate synthase large subunit 1, chloroplastic-like
  KO
K13789  geranylgeranyl diphosphate synthase, type II [EC:2.5.1.1 2.5.1.10 2.5.1.29]
Organism
vra  Vigna radiata (mung bean)
Pathway
vra00900  Terpenoid backbone biosynthesis
vra01100  Metabolic pathways
vra01110  Biosynthesis of secondary metabolites
Module
vra_M00366  C10-C20 isoprenoid biosynthesis, plants
Brite
KEGG Orthology (KO) [BR:vra00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    106756883
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:vra01006]
    106756883
Enzymes [BR:vra01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.1  dimethylallyltranstransferase
     106756883
    2.5.1.10  (2E,6E)-farnesyl diphosphate synthase
     106756883
    2.5.1.29  geranylgeranyl diphosphate synthase
     106756883
Prenyltransferases [BR:vra01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   106756883
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: polyprenyl_synt
Motif
Other DBs
NCBI-GeneID: 106756883
NCBI-ProteinID: XP_014494970
UniProt: A0A1S3TMH3
Position
3
AA seq 332 aa AA seqDB search
MSFANFGRWAPLRSMPMKRNTRSLLSPIDTVGREEIGFNFQAYMQHKINTVNRALDAAIE
LKEPKIIHEAMPYTLLPGGKKIRPVLCIAACELVGGTDYTAVPAACAVEMVHAMSLIHDD
LPSIDNDDLRRGKPACHKVFGENVAILAGDALQACAFEHLAASTKGVSPTRVVRAIVELA
KSVGAEGVAGGQVMDVSSEGLSSEVGLERVELIHLKKSAVLMEVAVVLGAIRGGGSDEEV
EKLRMFGRCVGLIGQIVNDIEDVTKSTEELGRTAGKDLVVDKVTYPKVFGMDKSMEIAEK
LVEDSKEILAGFDNPKVVPLCAVTNYIAGKIN
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgagttttgcgaattttggaagatgggctcctttgaggtctatgccgatgaagaggaac
acacgttcacttctcagtcccatagacactgtgggaagagaagaaattggattcaatttc
caagcttacatgcagcacaagattaacacagtgaaccgagccttggacgctgcaatcgag
ctcaaggagcccaagattatccacgaagccatgccctacacgctcctcccaggcggcaag
aagatccgcccggtgctctgcatcgccgcgtgcgagctcgtcggaggaaccgattacacc
gccgtacccgccgcatgcgctgtcgagatggtccatgccatgtcgctcatccacgacgac
ttgcccagcattgacaacgatgacctacggcgagggaagccggcgtgccacaaggtcttt
ggcgagaacgtggcgatcctcgcaggcgatgcgctgcaggcctgcgcgttcgagcacttg
gcggcgtcgacgaagggcgtgtctcccactcgcgtggttcgcgcgatagtggagttggcg
aaatcggtcggcgcggaaggcgttgcggggggacaagtgatggatgtgagctcggaaggg
ttgtcgagtgaggtgggtttggagagggtggaattgattcaccttaagaaatcggcggtg
ttgatggaagttgcggttgtgttgggagcaataagggggggtgggtcggacgaggaagtt
gaaaagttaaggatgtttggtcggtgcgttgggttgataggtcagattgtgaatgatatt
gaagatgttacgaaatcgacggaggagttggggcggacggcggggaaggacttggtggtt
gataaagtcacatatcccaaggtttttggaatggataagtctatggagattgctgagaaa
ttggtggaggattccaaggaaatcttggctgggtttgataacccaaaggtagttccactg
tgtgctgtaactaattacattgcaggcaaaattaattag

DBGET integrated database retrieval system