KEGG   Vigna radiata (mung bean): 106759080Help
Entry
106759080         CDS       T04126                                 

Definition
(RefSeq) uncharacterized protein LOC106759080 isoform X2
  KO
K02890  large subunit ribosomal protein L22
Organism
vra  Vigna radiata (mung bean)
Pathway
vra03010  Ribosome
Brite
KEGG Orthology (KO) [BR:vra00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    106759080
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:vra03011]
    106759080
Ribosome [BR:vra03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    106759080
  Bacteria
    106759080
  Archaea
    106759080
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-GeneID: 106759080
NCBI-ProteinID: XP_014497578
UniProt: A0A1S3TUX3
Position
4
AA seq 214 aa AA seqDB search
MFGDFNKQGISSTAPLLANSSEEAPVLSPLVPISSLGGSKGEDQKQKAVTKPKTVQAILK
GIKQSPKKVNLVAALVRGMLVKDALMQLELTIKRAAKTVYQVIHSARANASHNHGLDPER
LIVAEAFVGKGYFKKRISFHGCGKSGTILKPECRLTVVVREITPKEEADIARLRVHNFKK
LSKRERRLVPHQLIETTPVWGRKNKSSVQNFSAA
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atgtttggagattttaataaacagggaatttcaagtactgctccattgctggcaaattca
tctgaggaagcacctgttttgtcacctttagtcccaatttcatctttgggtggttcaaaa
ggtgaagaccagaagcagaaagctgttactaagccaaaaacggttcaagcaatattaaag
ggaataaagcagagtccgaagaaggtcaacctagttgctgctctggttcgtggcatgctt
gttaaagatgcattaatgcagctggaattgacaataaaaagagcagcaaaaactgtttat
caggttatacattcggcccgagcaaatgcctctcacaatcatgggttagatccagaacgc
ctcattgtagcggaagcatttgtaggaaaggggtatttcaaaaagagaatttccttccat
ggctgtggaaaatcagggaccatattgaaaccagaatgccggctaacagttgtagtgaga
gagataacaccgaaagaagaggctgatattgctaggttgagagttcacaactttaagaaa
ctaagtaagcgggagagacgacttgtgcctcatcaacttattgagaccactcctgtttgg
ggccgcaaaaacaaatctagtgttcaaaacttcagtgctgcttaa

DBGET integrated database retrieval system