KEGG   Vigna radiata (mung bean): 106760203Help
Entry
106760203         CDS       T04126                                 

Definition
(RefSeq) glucose-6-phosphate 1-dehydrogenase, chloroplastic-like isoform X4
Organism
vra  Vigna radiata (mung bean)
SSDB OrthologParalogGFIT
Motif
Pfam: G6PD_N
Motif
Other DBs
NCBI-GeneID: 106760203
NCBI-ProteinID: XP_014499152
UniProt: A0A1S3TZG4
Position
5
AA seq 188 aa AA seqDB search
MLETPSCAVAPVRRLAASRLSPSFYRHRSSPPPQPSHAGAVAAFVTPVENGTSHKQLNAE
LLSVKSPKDSLVEDSFQKDENESTISITVVGASGDLAKMIFPALYALYYEDCLPKHFSIY
GYTRSKMTDTELRNMVSRILTCRIDKRENCNEKMEQFLKRCFYHSGQYDSQENFAVLDKK
KLKEQEML
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atgctggagacgccatcatgcgcggtggctccagtccgccggcttgcagcatctcgcctc
tcccctagcttctaccgccatcgatcatcgcctcctccccaaccttctcatgcaggtgca
gtagctgcttttgtgacacctgttgaaaatggcacttctcacaagcagctgaatgctgaa
ttattgtctgttaagtccccaaaggattctctagttgaagacagttttcaaaaggatgaa
aatgagtccactattagtattactgttgttggagcctctggagaccttgctaagatgata
tttccagctctctatgcactttactatgaggattgtctccctaagcacttcagtatctat
ggttacacacgaagtaagatgactgatacagaactgagaaatatggttagtaggatcctc
acttgtagaattgataagagagagaactgcaatgagaagatggagcaattcctaaaaaga
tgtttctatcattctggtcaatatgattctcaggaaaactttgcagtgctagacaagaag
aagctgaaggaacaagagatgctgtaa

DBGET integrated database retrieval system