KEGG   Vigna radiata (mung bean): 106761337Help
Entry
106761337         CDS       T04126                                 

Definition
(RefSeq) long chain acyl-CoA synthetase 9, chloroplastic
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
vra  Vigna radiata (mung bean)
Pathway
vra00061  Fatty acid biosynthesis
vra00071  Fatty acid degradation
vra01100  Metabolic pathways
vra01212  Fatty acid metabolism
vra04146  Peroxisome
Module
vra_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:vra00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    106761337
   00071 Fatty acid degradation
    106761337
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    106761337
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:vra01004]
    106761337
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:vra04147]
    106761337
Enzymes [BR:vra01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     106761337
Lipid biosynthesis proteins [BR:vra01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   106761337
Exosome [BR:vra04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   106761337
  Exosomal proteins of breast cancer cells
   106761337
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AMP-binding AMP-binding_C CBM9_2
Motif
Other DBs
NCBI-GeneID: 106761337
NCBI-ProteinID: XP_014500363
UniProt: A0A1S3U2W3
Position
5
AA seq 695 aa AA seqDB search
MNAYIFGIVVPLLVILFRSRSSTKRRGLPADVGGERGLALRNHRFTSPLSSAWEGVTTLA
ELFERACREHHDRVLLGTRVEIAREVDFSYGRRLEKLHLGDYHWLTYGRVFESVTSFASG
LALLGHRKEERVAIFAETRDRWFIALQGCFRRNVTVVTIYSSLGEEALCHSLNETDVTTV
ICGRKELTSLVHISGQLDSVKRVICIDDDKISSDLFAQTGWKITSFADVESLGRDNPVEA
DLPLSADVAVIMYTSGSTGLPKGVMMTHGNVLATVSSIMIIVPNLGPKDVYLAYLPMAHI
LELVAENLIAAVGGSIGYGTPLTLTDTSNKIMKGKRGDATALMPTVMAAVPAILDRVREG
VLKKVNAKGGLSKKLFYLAFARRLLALNGSWFGAWGWEKALWNLLVFKKVQAILGGRIRF
ILCGGAPLSGDTQRFINICLGAPIGQGYGLTETCAGGTFSDFDDTSVGRVGPPIPCSYIK
LIDWPEGGYSTNDSPMPRGEIVIGGPNVSLGYFKNEEKTIESYKVDERGVRWFYTGDIGR
FHKDGCIEIIDRKKDIVKLQHGEYVSLGKVEAALSTSPYVDNIMLHADPFHSYCVALVVA
SHPALEQWASQQGIAYSNNFSELCRKEETVKEVHASLLKEAKKGRLEKFEIPAKIICLSE
PWTPESGLVTAALKLKREIIRKAFQEELSKLYSSV
NT seq 2088 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcctatattttcggtatcgttgttcctctcctcgtcatcctcttccgcagccgc
agttccaccaagcgccgcggcctcccagccgacgttggcggcgagcgcggcctcgcgctg
cggaaccaccgcttcacttcgccactcagttctgcctgggagggcgttacgacgctggcg
gagctcttcgagcgcgcatgcagggagcatcatgaccgtgtgctgctcggcacgcgcgtg
gagatcgcgcgtgaagtggacttctcttatggtagaaggctcgagaagcttcacctgggg
gactaccactggcttacttacgggagagtcttcgaatccgtcacgagtttcgcttccggt
ttggcgttgctcggtcatcgcaaggaagagcgcgtggctatattcgctgaaaccagagat
cgttggtttattgcactgcagggatgcttcaggaggaatgtgacagttgtgaccatatat
tcgtcattgggagaggaagctttgtgtcactcgttgaatgagacagatgtcacaacagtg
atatgtgggcgcaaagaattgacgtcactagtacatatcagtggtcaacttgattctgtg
aaacgtgttatatgcattgacgacgacaagatttcatctgatttgtttgctcagactgga
tggaaaatcacttcctttgctgacgttgagagccttggtagagacaatcctgttgaggct
gatttacccctttcagccgatgttgcagttataatgtacacaagtggaagtacaggattg
cccaagggtgtaatgatgacacatggcaatgtcttggcaacagtctcttcgataatgatt
atagttcctaaccttgggccaaaggatgtctatcttgcctacttaccgatggctcacatc
cttgaattagtagctgagaatttgattgcagctgttggaggtagtataggatatggaact
cccttgactttaactgatacatcaaacaaaataatgaaggggaaaaggggggatgccact
gcattgatgccaactgtgatggcagctgtaccagcaattcttgatcgtgtacgcgaagga
gtgctcaagaaggtaaatgcaaaaggaggattgtcaaagaaattgttttatttagccttt
gcacgaaggttgcttgcacttaatggtagctggtttggtgcttggggctgggaaaaagct
ctatggaatcttcttgtgttcaagaaggttcaagcaattttgggtggtcgcattcggttt
atactatgtggtggtgctccactctctggtgacacccaaagattcatcaacatttgtctt
ggtgctccaataggtcaaggatatggtctcactgagacttgtgctggtgggacattctct
gatttcgacgatacgtctgtgggccgtgttgggccacctattccttgctcatatattaaa
ctaattgactggcccgaaggtggatattcaactaatgactcgcccatgcctcgtggtgaa
attgtgattggaggtccaaatgtcagtcttggttacttcaaaaatgaagaaaaaacaata
gaatcttacaaggttgatgaaagaggagtaaggtggttctacactggtgatatcgggaga
tttcataaagatggttgcattgagatcattgatcggaaaaaggacatagttaaactccag
catggggaatatgtgtccttgggaaaggtggaggcagctctttctaccagtccctacgtc
gacaatatcatgttgcatgctgacccttttcatagctattgtgtggcacttgtcgtagct
tctcatccggcattggagcaatgggcttcacagcaaggaattgcttattctaataatttt
tcagaactgtgcaggaaagaagaaactgtgaaggaggtgcatgcatcacttttaaaggaa
gcaaagaagggtcgtctggaaaagtttgagattcctgcaaaaattatttgcctttctgag
ccatggactcctgaaagtggcctagtcactgcagctcttaagctgaagagagagatcatt
agaaaggcttttcaagaggagctttcaaagttatattcctccgtctag

DBGET integrated database retrieval system