KEGG   Vigna radiata (mung bean): 106761862Help
Entry
106761862         CDS       T04126                                 

Definition
(RefSeq) protein PHYLLO, chloroplastic isoform X1
  KO
K14759  isochorismate synthase / 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylate synthase / 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase / O-succinylbenzoate synthase [EC:5.4.4.2 2.2.1.9 4.2.99.20 4.2.1.113]
Organism
vra  Vigna radiata (mung bean)
Pathway
vra00130  Ubiquinone and other terpenoid-quinone biosynthesis
vra01100  Metabolic pathways
vra01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:vra00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    106761862
Enzymes [BR:vra01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.9  2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylic-acid synthase
     106761862
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.113  o-succinylbenzoate synthase
     106761862
   4.2.99  Other carbon-oxygen lyases
    4.2.99.20  2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase
     106761862
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.4  Transferring hydroxy groups
    5.4.4.2  isochorismate synthase
     106761862
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TPP_enzyme_N Abhydrolase_6 Abhydrolase_1 TPP_enzyme_M_2 MR_MLE_C Hydrolase_4 TPP_enzyme_C Ndr Abhydrolase_2 BAAT_C Abhydrolase_3 Thioesterase TPP_enzyme_M DLH Esterase
Motif
Other DBs
NCBI-GeneID: 106761862
NCBI-ProteinID: XP_014500923
UniProt: A0A1S3U4F3
Position
5
AA seq 1692 aa AA seqDB search
MILAVSALGRWRISNSEMFMVEGAAYNFGIGMRSARVWNGASRSELAGVVGVRFDGPVPL
NGDVLEKEVLFEQCVTRTLSPALTLEEGLEKLKDALHTLKLQRPPSSTGFLRFQVAVPPG
SKALALFCSQPLSSSVFPLAYLSKHNADPKSLYVNGARGVCAIGAAVSFLPPTSNHRSSV
NRYVSSDSADVVAYGFMDVNLDDGNVSHQEGSFWFFIPQIELDELESVSVLTMSLAWDEF
SQSTFQEAYYLLEVSLDQVMCHVWSTINKGKSKCTRGALRKLNLVEDRSIPRVYMNTIAP
GGRECLSEIMELRESPSCSQFCLRLSATLAVSNNMLDRANELSHSLKESANINAVWASLI
VEECTRLGLMYFCIAPGSRSSPLAVAAASHKLVTCISCFDERSLAFHAVGYGRGSHIPAV
VITSSGTAVSNLLPAVVEASQDFVPLILLTADRPPELLDCGANQAIDQVNHFGSFVRFFF
NLPAPTDQIPAKMVLTTLDSAVHRSTSSPCGPVHINCPFREPLESSPCKWLSSCLTGLDF
WMSNAEPFTKYIHMQLSHTSTNVPGEMSEVLDLIQKSKNSLLLFGAIHTEDEMWAALLLA
KHLHWPVVADILSGLRLRTLLSSFPDIERNFIFVDNLDQALLSDTVKGWLEVDVVIQIGS
RLTSKRVCQILEDRAPFSYIMVDKHPHRHDPSHIITHRIQTSIFEFVGCLLKASISNTRS
MWGISLQLLSKMVEWEIKFQITAECSLTEPYVAHVISDALSSESALFLGNSMPIRDANLY
GCSWSICNQSVSSLMLNSDLPINLTRVAANRGASGIDGLLSTAIGFAAGCNKKVLCVVGD
ISLLHDTNGLAILNQRKLRKPMTILVVNNHGGAIFSNLPLADKVETSIMHQYFYTSHNIS
IRELCMAHGIKHLHVMTKEELKEALCVAQHEQMDCMIEIESSIDANASFHSILKKFALQT
VQHTMNYLSWVFNEGSIHDEFCLYKICKIQCSKYRIALKAPPTSTFVVDSCKEFYKEGFI
LSLELEDGSVGYGEVAPIGIHRENLLDAEYQLRFLIHVMEHVDVSCFLSLLRGSFSHWIW
HELGIMPSFIFPSVRCGLEMAILNAIANAKGSNILNILHPSINENNCETSLNVQICALID
SNGSPTEVANAAAKLIEEGFSAIKLKVARRGDPMLDAAIIQEVRKKVGCQVIIRADANRS
WTYEEAMKFSSLVKDCNLQYIEEPVQDEDNILKFCEESGLSIALDETIDNMQENPMEKLV
KFTHPAIAAVVIKPSVVGGFENAALIAQWAYHMGKMVVVSAAFESSLSLSAYTQFSSYLE
MLSLGTFKVLDNVAAPAVAHGLGTYRWLKEDVTPNPLFIYRNPKSGFVEASVEDASRLVR
DFQVNKKVVSYVIVEEEVRQYQCRIELNNVSCSFEVRETGLQTNDNVLVFLHGFLGTGED
WINIMKTFSGSAKCISVDLPGHGKSILHGLEGVGEEPWLSLETVADILHELVHHIAPGKV
TLVGYSMGARIALFMALKFGTKIKGAILISGSPGLNDKLSRKIRAAKDDSRASTVITHGL
QLFVSSWYAGELWKSLRSHPHSSRIIASRLQHDDVQSLAQMLSGLSIGRHLSMWEDLPNC
RVPLLIIHGEKDTKFRNIAQKMMKTLCSGLGSKHENGIAIHEVVEIPNCGHAAHLENPLA
IIAAIARYLTRL
NT seq 5079 nt NT seq  +upstreamnt  +downstreamnt
atgattttggcagtgtcggcgttgggaagatggaggatcagcaatagcgaaatgtttatg
gttgagggtgctgcctataatttcggaatcggaatgcgaagtgccagagtgtggaacggc
gcgagccggagtgagctggccggagtcgtcggagtgaggtttgatggaccggtgccccta
aacggcgacgttctggagaaggaagtgctcttcgagcagtgcgtgacgcggactctatct
ccggcgttgacgttggaggaggggctcgagaaattgaaggacgctctccacacgttgaag
ttgcagaggcctccttcctctaccggattcctccgatttcaggtcgcagttcctcctggt
tccaaggccttagctctcttctgctctcaacccctctcctcctccgtcttccctctcgct
tacctttccaagcacaatgctgatcctaagtcgctctacgtcaacggagcccgcggcgtt
tgtgccatcggtgccgctgtttcctttctccctccaacctcaaaccaccgctcttccgtc
aatagatatgtgtcatctgactccgccgatgtagtggcctatggttttatggatgttaat
ttggatgatggtaatgtgagtcaccaggaaggatctttttggtttttcatccctcagatt
gagttggatgagctggaaagtgtttccgttctgaccatgtcccttgcatgggatgaattt
tcccagtctacttttcaagaagcctattatttgcttgaagtttctctagaccaggttatg
tgtcatgtttggtccactatcaacaaagggaaatccaaatgtactagaggtgctctcaga
aaactaaatttggttgaagatagatccattccaagggtctacatgaacactattgcaccg
ggaggaagagaatgtttgagtgagatcatggaactgagagagtctccgtcttgcagtcaa
ttttgtttaaggctatcagcaacccttgctgtttcaaacaatatgttggatcgtgccaat
gaattatcgcactcactgaaagaaagtgctaacattaatgctgtttgggcatcacttatt
gttgaagagtgcacaagacttggtttgatgtatttctgtattgctcctggatctagatct
tcccctcttgctgttgctgctgcaagtcacaaattagtcacttgtatttcatgctttgat
gagcgttcacttgcatttcatgctgttggatatggaagaggatctcacattccagcagta
gtcataacatcatcaggcacagcagtttctaaccttcttccagctgttgtggaggcaagt
caagattttgtgcctcttattttacttactgcagatcgacctccagagcttttggattgt
ggggcaaaccaagcaattgatcaggtgaaccattttggttctttcgtgagatttttcttt
aatctccctgcacccacagatcaaattcctgcaaagatggtgctcacgactcttgattct
gctgtacataggtcaacttcttcaccatgtggtccagtacatatcaactgcccttttaga
gagcctttagaaagcagtccctgtaaatggttgtctagctgtttgacagggttagatttc
tggatgagtaatgctgaaccatttaccaaatatattcatatgcaattgtctcatactagt
acaaatgtgcccggtgaaatgtctgaagtcttggatctgattcaaaagtccaagaatagt
cttctactatttggtgcaatccacacagaagatgagatgtgggctgctctgcttttggct
aaacaccttcactggcctgttgtagcagatatcttgtcagggttgcggttgagaactctt
ttaagttcttttcctgatattgaaagaaattttatatttgttgataatcttgatcaagct
cttctctcagatactgtcaagggctggttagaggttgatgtggttattcagataggaagc
aggctaacaagcaaacgagtctgccaaattcttgaggatcgtgctcctttttcatatatt
atggttgacaaacatcctcatcggcatgatccatcacatattataactcatcgtatacaa
acttcaatttttgaattcgtgggctgtttacttaaggcttcaatttcaaatactaggagc
atgtggggcatttccctacaactgttgagtaaaatggttgagtgggagataaaatttcaa
attactgcagaatgctcccttactgagccttatgttgcacatgtgatatcagatgctctt
tcctccgagtctgctctatttcttggtaacagtatgcctattcgggatgcaaatttatat
ggatgcagttggtctatatgcaatcaaagtgtttcatcactaatgttaaattccgaccta
ccaattaacttgacaagagtggctgctaacaggggtgctagtggtatagatgggttgctt
agcacagccattggttttgctgcaggatgcaacaaaaaggtgttgtgtgtagttggagat
atttctttattgcatgatacaaatggcttggcaattttgaaccagcggaaactgcggaaa
ccgatgacaattcttgtggttaataatcacggaggagcaattttcagtaatcttcccttg
gcagataaagttgaaacatccataatgcatcaatacttctatacctctcacaacatttca
atacgtgaactatgcatggcacatggcatcaaacatttacatgtgatgacaaaggaagaa
cttaaggaagctttgtgtgtagctcaacatgaacaaatggactgtatgattgaaattgag
agttccattgacgccaatgccagttttcacagcattttgaagaaatttgcactccaaaca
gttcaacacaccatgaattatctctcatgggttttcaatgaaggctctatacatgatgag
ttttgtttatacaaaatttgtaaaatccaatgttctaaatatagaattgcacttaaagct
ccaccaacatcaacatttgtggttgatagctgtaaggaattctacaaagaaggatttatt
ctatccttagagcttgaagatggaagtgttggatatggtgaggttgcacctattggcatc
cacagggaaaatctgctagatgctgaataccaacttaggtttcttatccatgttatggaa
catgttgatgttagttgcttcctgtctctattgaggggttcattttcacattggatatgg
catgagttgggcatcatgccatcttttatttttccaagtgtaagatgtggtttggaaatg
gctatcctcaatgccattgctaatgcaaaaggctccaacattctgaacatactccatccc
tcaataaatgagaacaattgtgaaacgtcattaaatgttcagatttgtgcattaattgat
tcaaatggatctccaactgaagttgctaatgctgctgccaaactaattgaggaaggattt
tctgcaattaagctgaaggtagcacgcaggggtgatccaatgcttgatgcagcaataata
caagaggtgagaaagaaagttggttgccaggttatcatccgtgcagatgctaatcgaagc
tggacttatgaagaagctatgaaattcagctctttggttaaggattgtaacctacagtat
attgaggagcctgttcaggatgaagataatattctcaagttttgtgaagaaagtggctta
tctattgccctagatgaaaccatagataacatgcaagaaaatcccatggaaaagctagtg
aagtttactcatccagcaatagctgcagtcgttattaaaccgagtgttgttggtggattt
gagaatgcggcattaattgctcaatgggcctaccatatggggaagatggtcgttgtaagt
gctgcatttgaaagcagtcttagtctttctgcatatactcagttttctagttatcttgaa
atgctgagtttaggtacattcaaagtgttagataatgtggcagcacctgctgtagcacat
ggtctcggaacctaccgttggcttaaggaagatgtaacaccaaatcctctttttatttat
cgtaatccaaaaagtggttttgttgaagcgtccgtggaagatgctagtcgattggtccgt
gattttcaagtcaacaaaaaagttgtctcatacgttattgttgaggaggaagttcgtcag
taccaatgtagaatagagcttaacaatgtatcttgttcttttgaagttcgcgagactggc
cttcaaacaaatgataacgtgctggtatttcttcatggatttcttggaactggtgaagac
tggattaatatcatgaagaccttttctggatcagcaaagtgcatttctgttgaccttcct
ggtcatggaaaatcaatactacatggcttagagggtgttggtgaggaaccatggctgtca
ttggagacagttgctgatatattgcatgaattagttcaccacatagctccaggaaaggtt
acactagtcgggtactcaatgggcgcaaggattgcattgtttatggctctcaaatttggc
accaagataaagggtgccatattaatatctggaagccctggattaaatgataaattatca
agaaaaattcgtgcggctaaagatgattctagagcatccacagtcattacacatggctta
caactttttgtcagttcctggtatgctggagagttgtggaaaagcttacgaagtcatccc
cattccagtcgaattattgctagtcgcttgcagcatgatgacgtgcagagtcttgcacag
atgctgtctggattaagcataggaaggcatctgtcaatgtgggaagatttgccaaattgt
agagtacctcttcttatcattcacggagaaaaggatacaaaatttagaaatattgctcag
aaaatgatgaaaacgttgtgctctggcttggggagtaagcatgaaaatgggattgctata
catgaggttgttgagattcccaactgtggccatgctgctcatttggagaatcctcttgct
atcattgctgccatagcacgatacctgactagactatga

DBGET integrated database retrieval system