KEGG   Vigna radiata (mung bean): 106762177Help
Entry
106762177         CDS       T04126                                 

Definition
(RefSeq) NADPH--cytochrome P450 reductase
  KO
K00327  NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
vra  Vigna radiata (mung bean)
Brite
KEGG Orthology (KO) [BR:vra00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    106762177
Enzymes [BR:vra01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     106762177
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_1 Flavodoxin_1 NAD_binding_1
Motif
Other DBs
NCBI-GeneID: 106762177
NCBI-ProteinID: NP_001304239
UniProt: P37116
Position
5
AA seq 690 aa AA seqDB search
MASNSDLVRAVESFLGVSLGDSVSDSLLLIATTSAAVVVGLLVFLWKKSSDRSKEVKPVV
VPRDLMMEEEEEVDVAAGKTKVTIFFGTQTGTAEGFAKALAEEIKARYEKAAVKVVDLDD
YAADDDLYEEKLKKESLVFFMLATYGDGEPIDNAARFYKWFTEGKDERGIWLQKLTYGVF
GLGNRQYEHFNKIGKVVDEELAEQGAKRLVAVGLGDDDQSIEDDFSAWKESLWSELDQLL
RDEDDANTVSTPYTAAILEYRVVIHDPTAASTYDNHSTVANGNTEFDIHHPCRVNVAVQK
ELHKPESDRSCIHLEFDISGTSITYDTGDHVGVYAENCNETVEETGKLLGQNLDLFFSLH
TDKDDGTSLGGSLLPPFPGPCSLRTALARYADLLNPPRKAALLALATHASEPSDERLKFL
SSPQGKDEYSKWVVGSQRSLVEVMAEFPSAKPPLGVFFAAIAPRLQPRYYSISSSPRFAP
QRVHVTCALVYGPTPTGRIHKGVCSTWMKNAIPSEKSQDCSSAPIFIRPSNFKLPVDHSI
PIIMVGPGTGLAPFRGFLQERYALKEDGVQLGPALLFFGCRNRQMDFIYEDELKSFVEQG
SLSELIVAFSREGAEKEYVQHKMMDKAAHLWSLISQGGYLYVCGDAKGMARDVHRTLHSI
VQEQENVDSTKAEAIVKKLQMDGRYLRDVW
NT seq 2073 nt NT seq  +upstreamnt  +downstreamnt
atggcttccaattccgatttggtgcgcgccgttgagtcgttccttggcgtttctctagga
gattccgtttcggattcgctgcttctcatcgccaccacctccgcggcggttgtagtcggt
cttctcgtgtttttatggaagaaatcttcggatcggagcaaggaggtgaagccggtggtt
gtgccgagggatttaatgatggaggaggaagaggaagttgacgttgccgccggcaagact
aaggtcaccattttcttcggtactcagaccggtactgctgaaggctttgctaaggcgttg
gcagaggagatcaaggcaaggtatgaaaaagcggctgtcaaagttgttgacctggatgac
tatgcagctgatgatgatctatatgaggagaagctgaagaaagagagtcttgtatttttc
atgctagcaacttacggggatggagaaccaatagacaatgctgcaagattctacaaatgg
tttactgaggggaaagacgaaaggggaatctggcttcaaaaactcacctatggagttttc
ggcctaggtaacaggcaatacgaacattttaataagataggtaaagttgtggatgaagaa
cttgctgaacaaggtgcaaagcgtctagttgcagttggattaggtgatgatgatcaatcc
attgaagatgatttttctgcctggaaagaaagtttatggtctgagttggatcagttgctc
agagatgaggatgatgctaatactgtctctactccctatacagctgctattcttgaatac
cgagtagtgattcacgatcccactgcagcatcaacctatgataatcactcaaccgtggca
aatgggaatactgagtttgatattcatcatccttgcagggtgaatgttgctgtacaaaag
gagcttcacaaacctgagtctgatcgttcttgcatacatttggaatttgatatatcgggg
acgagcataacatatgatactggagaccatgtgggtgtttatgctgagaactgcaatgaa
actgtcgaagaaactgggaagttgttgggtcagaatttggatctatttttttctcttcac
acagacaaggatgatggcacttccctaggtggttctctcctacctcctttccctggccct
tgttcactgcgaactgcattagcacgttatgctgatctcttgaaccccccacgaaaggct
gctttacttgcattggctactcatgcctctgaacctagcgacgaaagattaaagttcctt
tcatctcctcaggggaaggatgagtattccaaatgggtggttggaagccagaggagtctc
gttgaggtgatggctgagtttccatcagcaaaacctcctcttggtgtgttttttgctgca
atagcccctcgtttacagcctcgttattattctatttcatcctctccaaggtttgctcct
caaagggtacatgtaacttgtgctttggtgtatggtccaactcccactggtagaattcac
aaaggtgtatgttcaacttggatgaagaatgctattccctcagaaaaaagtcaagactgt
agctcggctcctatttttattaggccatcaaatttcaagcttccagttgatcattcaata
cctattattatggttggacctggtaccggtcttgcacctttcaggggatttttgcaggaa
agatatgctctcaaagaggatggtgttcaacttggccctgcattactcttctttggatgt
agaaatcgtcaaatggatttcatttatgaggatgagctaaagagttttgtggaacaaggt
tctctttcagaattgatagttgcattctctagagagggggctgaaaaggaatatgttcaa
cacaagatgatggacaaagctgcgcacctttggagtttgatttctcaaggaggttatctt
tacgtctgtggagatgccaagggcatggccagagatgtccatcgaactcttcattccatt
gtccaggagcaggaaaacgtggactcaacaaaagctgaagctatagtgaaaaaactccag
atggacggacgttaccttagagatgtatggtga

DBGET integrated database retrieval system