KEGG   Vigna radiata (mung bean): 106762541Help
Entry
106762541         CDS       T04126                                 

Definition
(RefSeq) beta-fructofuranosidase, soluble isoenzyme I
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
vra  Vigna radiata (mung bean)
Pathway
vra00052  Galactose metabolism
vra00500  Starch and sucrose metabolism
vra01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vra00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    106762541
   00500 Starch and sucrose metabolism
    106762541
Enzymes [BR:vra01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     106762541
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C DUF3357
Motif
Other DBs
NCBI-GeneID: 106762541
NCBI-ProteinID: XP_014501996
UniProt: A0A1S3U7L5
Position
5
AA seq 624 aa AA seqDB search
MEANLDHAPPHTPLLNHPHKNGDKPSKGIFLMLYSIVFLLSLLALTMIKSQNHLEKLEKS
SPFDSNISPRGLAQGVSPKSNPTLFQKVSYNWTNAMFSWQRTAFHFQPQKNWMNDPDGPL
FHMGWYHLFYQYNPDSAVWGNITWGHAVSRDMIHWLYLPIAMLPNKWYDINGVWTGSATV
LPDGKILMLYTGDTNKYVQVQNLAYPANLSDPLLLDWVKYTGNPILVPPPGIGSKDFRDP
TTGWIGPDEKWRVAIGSKKGKTGLSLVYTTIDFINFEQNDHYLHAVPGTGMWECLDFYPV
SINGSKGLDTSVNGPYVKHVLKASLDDARVDSYALGTYFVENDTWVPDNPLKDVGIGLLL
DYGRYYASKTFYDKENERRILWGWVNETDIESDDLRKGWASLQTIPRTVLFDNKTGSNLL
LWPVEEVESLRLSSDEFEGVVVKPGSVVPLNISLATQLDIFAEFEIEWLNSESIGESNIG
CGRGGAADRSAFGPFGLLAIADDSLSEQTPIYFRLSNTTTFFCVDETRSSKASDVAKPIY
GSQVPILSDEKLSMRVLVDHSIIESFAQGGRTVITSRIYPTEAIYGAARLFVFNNATDIN
IKISLKIWQLNSAFIRPFPFDQNQ
NT seq 1875 nt NT seq  +upstreamnt  +downstreamnt
atggaggccaatcttgatcatgctccaccacacacccctttgcttaatcacccacacaaa
aatggcgataaaccatcaaagggtatctttttgatgctttattccattgtttttcttctg
tcattgcttgcattgaccatgatcaagagccaaaaccacttagaaaaactggagaaaagc
agcccttttgattctaacatctcccccagaggattggctcaaggtgtttctcccaaatcc
aatccaacccttttccagaaagtttcatacaattggaccaacgccatgttttcttggcaa
agaacagcttttcattttcagccacaaaaaaactggatgaatgatcctgacggtccattg
tttcacatgggatggtaccatctgttctaccaatataatccagattcagctgtgtggggg
aacatcacatggggccatgcagtatcaagggacatgattcattggctctatctacccatt
gccatgcttcctaacaagtggtacgatatcaacggtgtatggactggatctgccacggtt
ctgccagatggcaaaatcttaatgctttacacgggtgacaccaataagtatgtgcaagtg
caaaaccttgcataccctgccaatctatctgatccacttcttctcgattgggtcaagtac
acgggtaacccgatcttagtgcccccgcccgggatcggatccaaggacttccgagacccg
accacgggttggatcgggccggatgaaaaatggagggtcgcaattgggtcaaagaaagga
aaaacgggcctttcgttagtttacacaaccattgatttcatcaactttgagcaaaatgat
cactacttgcatgcagttccgggtacgggtatgtgggaatgtttagacttttacccggtt
tcgataaacgggtctaagggtttggatacttcagttaatgggccatatgttaagcacgtc
ttaaaagctagtttggatgacgcaagggtagatagttatgcactaggaacttattttgtt
gaaaacgacacatgggtacccgataacccgcttaaggatgtgggtatcgggttgcttttg
gactatgggagatactatgcttcaaagactttctatgacaaagaaaacgagaggagaatt
ctatggggttgggtcaatgaaactgatatagaaagtgatgacttaagaaagggttgggct
tctcttcagacaattccaagaacagtgttgtttgataacaagactgggagtaatttgctt
ctgtggccagtggaggaagtagaaagcttgagactaagtagtgatgaatttgaaggagtg
gtggttaagcctggctctgttgtgccactaaacataagcctagcgacacagttggacata
tttgctgaatttgagattgaatggttgaactccgaaagtattggtgagagcaacataggt
tgtggaaggggtggtgcagccgacagaagtgcttttggaccatttgggcttctagcaata
gcagatgactcactttcggaacaaaccccaatttattttcgcctttctaatactaccact
ttcttctgtgttgatgaaacaagatcatcaaaggcttctgatgtcgcaaagccaatttat
ggcagccaagttccaatccttagtgatgaaaaattatcaatgagggtattggttgaccat
tcaattattgagagctttgctcaaggagggagaactgtgatcacaagtagaatttaccca
actgaagcaatatatggagctgcaagattatttgtattcaacaatgcaactgacataaac
attaagatctccttaaagatctggcaattgaactctgctttcatacgaccctttcccttt
gatcaaaatcagtga

DBGET integrated database retrieval system