KEGG   Vigna radiata (mung bean): 106762595Help
Entry
106762595         CDS       T04126                                 

Definition
(RefSeq) non-specific phospholipase C6
  KO
K01114  phospholipase C [EC:3.1.4.3]
Organism
vra  Vigna radiata (mung bean)
Pathway
vra00562  Inositol phosphate metabolism
vra00564  Glycerophospholipid metabolism
vra00565  Ether lipid metabolism
vra01100  Metabolic pathways
vra01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:vra00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    106762595
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    106762595
   00565 Ether lipid metabolism
    106762595
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02042 Bacterial toxins [BR:vra02042]
    106762595
Enzymes [BR:vra01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.3  phospholipase C
     106762595
Bacterial toxins [BR:vra02042]
 Type II toxins: Membrane damaging toxins
  Toxins that enzymatically damage the membrane
   106762595
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Phosphoesterase Sulfatase DUF5338
Motif
Other DBs
NCBI-GeneID: 106762595
NCBI-ProteinID: XP_014502080
UniProt: A0A1S3U7S5
Position
5
AA seq 515 aa AA seqDB search
MGGGKSRSFILLLFLFVFLCVFARAQQQQPIKNVVVLVMENRSFDHMLGWMKERINALIN
GVTGDECNPVSTKGSKQDSICFTDDAEFVDPDPGHSFEDVLQQVFGSGSIPSMNGFVEQA
LSVSHNLSETVMKGFKPEAVPVYAALVKEFAVFDRWFSSIPGPTQPNRLFVYSATSHGST
SHVKRQLAKGYPQKTIFDSLHENGLDFGIYFQNIPTTLFYRNLRKLKYVFKFHQYDLKFK
RDARNGKLPPLTVIEPRYFDLKGLPANDDHPSHDVAHGQMLVKDVYEALRTSPQWNETLF
IITYDEHGGFFDHVKTPFVNIPNPDGNTGPAPYFFKFDRLGVRVPTIMISPWIKKGTVIS
GAKGPAENSEFEHSSIPATIKKIFNLSSNFLTHRDAWAGTFEHVVGELSSPRTDCPVTLP
DVTPLRSTEAKEDAGLSEFQSEVVQLAAVLNGDHFLSSFPDEMSKKMSVKEAHEYVRGAV
SRFIRASKEAIKLGADESAIVDMRSSLTTRSSVHN
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atgggaggtgggaagtccagatctttcattctattgctctttctctttgtgttcctctgt
gtttttgcaagggcgcaacaacagcaacctataaaaaacgttgttgttttggttatggag
aaccgttcctttgaccacatgctgggttggatgaaagagagaatcaacgcgttaatcaat
ggggtcacgggtgatgaatgcaaccctgtttctactaaaggttcgaagcaagattcaatt
tgcttcaccgatgatgcagagttcgtggatccggatcctgggcattcatttgaagatgtg
ttgcagcaggtattcgggtctggttcgatcccttccatgaatggatttgtggagcaagca
ttgtccgtgtctcacaacctctctgagactgtaatgaaagggtttaagcccgaggctgtg
ccagtttatgctgctttggttaaggaatttgctgtttttgataggtggttttcttcaatt
cctggtccaacacaacccaataggctttttgtgtactcagcaacctctcatggttccaca
agtcatgtcaagaggcagttagcgaaagggtaccctcaaaaaaccatctttgattctctg
catgagaatggcctggactttgggatttactttcagaacatacccacaactttgttctat
aggaatctgaggaaattgaagtacgtattcaagttccatcagtatgatttgaagttcaag
agagatgcccgaaatgggaagcttccacccttgactgtgattgagcctagatactttgac
ttgaagggcttacccgcgaatgatgaccacccatctcacgatgttgcacatggccaaatg
ctggttaaggatgtttacgaggctctaagaaccagccctcagtggaatgaaacacttttc
atcattacatatgatgaacatggtggattttttgatcatgtgaagaccccttttgtcaac
attcctaatccagacgggaacaccggacctgctccctatttcttcaagtttgataggtta
ggggttcgggttcctactattatgatctctccttggatcaagaaaggaactgtgataagt
ggtgccaaaggacctgctgaaaactcagaatttgagcactcttctattcctgcaaccata
aagaagatcttcaacctttcctccaactttttgacccacagggatgcttgggctgggaca
ttcgagcatgttgttggagagttaagttcacccagaacggattgcccagtgactttgccg
gacgtgacccctctaaggagcactgaagcaaaagaagatgcaggcctgtctgaatttcag
agtgaggtagttcaattggcagcagttcttaatggggatcatttcttgagcagtttccct
gatgaaatgagcaagaagatgagtgtgaaggaagctcatgaatacgttcgaggagctgtc
tcaaggttcataagagctagcaaagaggccatcaagttaggggctgatgaatctgccatt
gtggatatgagatcctctctcactactaggtcttcagttcataattaa

DBGET integrated database retrieval system