KEGG   Vigna radiata (mung bean): 106763453Help
Entry
106763453         CDS       T04126                                 

Definition
(RefSeq) hydroxymethylglutaryl-CoA synthase
  KO
K01641  hydroxymethylglutaryl-CoA synthase [EC:2.3.3.10]
Organism
vra  Vigna radiata (mung bean)
Pathway
vra00072  Synthesis and degradation of ketone bodies
vra00280  Valine, leucine and isoleucine degradation
vra00650  Butanoate metabolism
vra00900  Terpenoid backbone biosynthesis
vra01100  Metabolic pathways
vra01110  Biosynthesis of secondary metabolites
Module
vra_M00095  C5 isoprenoid biosynthesis, mevalonate pathway
Brite
KEGG Orthology (KO) [BR:vra00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    106763453
  09103 Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    106763453
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    106763453
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    106763453
Enzymes [BR:vra01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.10  hydroxymethylglutaryl-CoA synthase
     106763453
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HMG_CoA_synt_C HMG_CoA_synt_N ACP_syn_III_C
Motif
Other DBs
NCBI-GeneID: 106763453
NCBI-ProteinID: XP_014503130
UniProt: A0A1S3UAT3
Position
1
AA seq 459 aa AA seqDB search
MASSRPTNVGILAMDIYFPPTCVTQEALEGHDGVSKGKYTIGLGQDCMAFCSEVEDVISM
SLTVVASLLEKFNVDPKQIGRLEVGSETVIDKSKSIKTFLMQVFEASGNTDIEGVDSTNA
CYGGTAALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIA
FESKLRGSHMSHAYDFYKPNLASEYPVVDGKLSQTCYLMALDSCYRILCEKFEKLEGRPF
SISDSDYFVFHSPYNKLVQKSFGRLYFNDFMRNLSFVDEAARETLAPYASLSGDESYQSR
DLEKANQQAAKHVYEAKVQPSTLIPKQVGNMYTASLYAAFASLLHNKNASLVGKRVVLFS
YGSGLTATMFSLRLREAQHPFNLSNIVTVMNVSDKLKQRLEIRPEEFVETLKIMEHRYGG
KDFVTSKDCSYLPPGTFYLTSVDSMYRRYYAKKDKVHPK
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atggcctcttcacgccctaccaatgtgggaatccttgccatggacatatacttccctcca
acctgcgtcacccaggaagctttagagggtcatgatggggtgagcaaagggaaatacact
attgggcttggacaggattgcatggctttctgctctgaggttgaagatgttatctcaatg
agcttgacagtagttgcttcacttcttgaaaaatttaatgttgatccaaagcaaattgga
cgcttggaggttggaagtgaaactgtgattgataagagcaaatccattaagacctttctg
atgcaagtttttgaggcgagtggtaatactgacattgaaggtgttgattcaacaaatgcg
tgctatggaggaacggcagctttgttcaactgtgtgaattgggtggagagtagttcatgg
gatggacgttatggacttgttgtatgtacagacagtgcggtatatgcagaaggacctgct
cgtcccactggaggagcagctgcaattgccatgcttgtagggccagatgctcctattgct
tttgaaagcaaactcagaggcagtcacatgtctcatgcatatgacttttacaagccaaat
cttgctagtgaatatccagttgttgatggaaaactctcacagacctgttatctcatggca
cttgattcgtgttatcggattttatgtgagaaatttgaaaaattggaggggaggcctttt
tcaatatcagattctgattattttgtgtttcattctccatataacaagcttgtgcagaaa
agttttggccggctatacttcaatgacttcatgagaaatctcagttttgttgatgaagct
gccagggagacccttgcaccatatgcttccttatccggtgatgagagttatcaaagtcgt
gatcttgaaaaggcaaatcagcaagctgccaaacatgtatatgaggcaaaggtgcagccc
agcacactaatcccaaagcaagttggtaacatgtacactgcatctctttatgcagcattt
gcctctcttcttcataataaaaacgcttcattggtgggtaaaagagtagttttgttttca
tatggaagtggtttaacagctacaatgttctccctccgccttcgagaggctcagcatccg
tttaacttgtcaaacattgtaaccgtgatgaatgtttcagacaagttgaagcagagactt
gagattcgtcctgaagagtttgtggaaacattgaagatcatggagcaccgttatgggggt
aaggactttgtgacaagcaaggactgcagctacttgcctccaggaaccttctatctcacc
agtgttgattctatgtacaggagatactatgccaagaaggacaaggtgcatccaaaataa

DBGET integrated database retrieval system