KEGG   Vigna radiata (mung bean): 106763749Help
Entry
106763749         CDS       T04126                                 

Definition
(RefSeq) probable pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH5
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
vra  Vigna radiata (mung bean)
Pathway
vra03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:vra00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    106763749
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:vra03041]
    106763749
Enzymes [BR:vra01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     106763749
Spliceosome [BR:vra03041]
 Complex C
  Other components
   Step II factors
    106763749
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HA2
Motif
Other DBs
NCBI-GeneID: 106763749
NCBI-ProteinID: XP_022637450
UniProt: A0A3Q0F076
Position
6
AA seq 137 aa AA seqDB search
MGINDLLSFDFMDLFSPQAYVSVMEQLYSLGELDEEGLLTKLGRKMAEFPLDPPLSKIML
ASVDLGCSDEILTIIAMIQTGNIFYRPREKQGRAYQKRAKFFQPEVTIVLYLLFMRFGKL
RTFQGRGVLRTLFNLDR
NT seq 414 nt NT seq  +upstreamnt  +downstreamnt
atggggataaacgatctattgtcctttgattttatggatttgttttcacctcaggcgtat
gtttctgttatggagcagctttacagtcttggagaattggatgaagagggcttgttaacc
aaactggggaggaaaatggcagaatttcctttggatccaccgttgtccaagattatgctt
gccagtgtggatcttggatgcagtgatgagattttgaccataattgccatgattcaaacc
ggaaacattttttacaggccaagggaaaagcaaggtcgagcatatcagaagagggcaaag
tttttccagccagaggtgaccatcgtactctacttactgtttatgaggtttggaaagcta
agaacttttcagggccgtggtgttttgagaactttgttcaatctcgatcgttga

DBGET integrated database retrieval system