KEGG   Vigna radiata (mung bean): 106764903
Entry
106764903         CDS       T04126                                 

Definition
(RefSeq) probable 1-acyl-sn-glycerol-3-phosphate acyltransferase 4
  KO
K13513  lysocardiolipin and lysophospholipid acyltransferase [EC:2.3.1.- 2.3.1.51]
Organism
vra  Vigna radiata (mung bean)
Pathway
vra00561  Glycerolipid metabolism
vra00564  Glycerophospholipid metabolism
vra01100  Metabolic pathways
vra01110  Biosynthesis of secondary metabolites
Module
vra_M00089  Triacylglycerol biosynthesis
Brite
KEGG Orthology (KO) [BR:vra00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    106764903
   00564 Glycerophospholipid metabolism
    106764903
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:vra01004]
    106764903
Enzymes [BR:vra01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.51  1-acylglycerol-3-phosphate O-acyltransferase
     106764903
    2.3.1.-  
     106764903
Lipid biosynthesis proteins [BR:vra01004]
 Phospholipid acyltransferase
  LPAAT/LPLAT
   106764903
SSDB
Motif
Pfam: Acyltransferase Acyltransf_C
Other DBs
NCBI-GeneID: 106764903
NCBI-ProteinID: XP_014504826
UniProt: A0A1S3UFL4
Position
6
AA seq 383 aa
MEVSGPVKSENRLKHRPLTPLRLLRGVICLVVFLSTAFMCLVYFVPVAVVGMRLFSIRYS
RKTVSFLFGLWLSLWPSLFEKINKTKVVFSGDSVPMKERVLLIANHRTEVDWMYLWDLAL
RKGTLGCIKYILKNSLMKLPIFGWGFHILEFIAVERKWEVDEQILHQKLSTLKDPQDPLW
LALFPEGTDYTDQKSKNSQKFAAENGLPVLKNVLLPKTKGFHACLEALRGSLDAVYDVTI
AYKNQCPSFLDNVFGVDPSEVHLHVRRIPVEEIPASESKASSWLIEKFKMKDHLLSDFKI
HGHFPDEQNENEISTLKSLFSFTVIVSFTAMFIYFTLFSVVWFKVYVGLSCAYLALATRF
NFQLMPLSNYVHALHYSKKQNTE
NT seq 1152 nt   +upstreamnt  +downstreamnt
atggaagttagcgggccagtgaaatctgaaaatagattaaagcaccgacccttgacccct
cttaggttgttgagaggtgtaatatgtttagtggtatttctttctacagcttttatgtgt
ttagtgtattttgtgccagtggcagttgtaggaatgcggcttttcagcatacgttatagt
aggaagacagtgtcattcctgtttggactttggctatctctgtggccatctctgttcgaa
aagattaacaaaaccaaagttgtgttttctggggatagtgttccaatgaaggaacgtgtt
ttgcttattgctaatcacagaactgaggttgattggatgtacttgtgggatcttgcactt
agaaaagggacactgggatgcataaagtacatccttaaaaacagcttgatgaaactacct
atctttggttggggatttcacattctggagttcattgcagtggagaggaagtgggaggta
gatgagcaaatactgcaccaaaagctttcaactttaaaggaccctcaagatcccttatgg
ctagctctttttcccgaaggaacagattatactgatcagaagagtaaaaacagtcaaaaa
tttgctgccgaaaatggtctccctgtgctgaaaaatgtattacttccgaaaacaaagggg
tttcatgcttgcttggaagccctacgaggctcattggatgcagtgtacgatgtgacaatt
gcatacaaaaatcaatgtccttcatttctggacaatgtgtttggtgttgatccttcagaa
gtgcacttgcatgtacggcgtattccagtggaggagattcctgcttctgaaagcaaagct
tcatcatggttgatagaaaagttcaagatgaaggaccacttgctttcagatttcaagatt
catggtcatttcccagatgagcaaaatgaaaatgaaatttctacattaaagagcctattc
tcttttacagtgatagtttcttttactgccatgtttatttattttacattattttctgtg
gtttggttcaaagtgtatgtaggtctatcttgtgcatatcttgctcttgcaacccgcttc
aattttcagttgatgcctctaagtaactatgttcatgcactccattacagcaagaaacaa
aacactgaatag

DBGET integrated database retrieval system