KEGG   Vigna radiata (mung bean): 106765124Help
Entry
106765124         CDS       T04126                                 

Definition
(RefSeq) alcohol dehydrogenase 1
  KO
K18857  alcohol dehydrogenase class-P [EC:1.1.1.1]
Organism
vra  Vigna radiata (mung bean)
Pathway
vra00010  Glycolysis / Gluconeogenesis
vra00071  Fatty acid degradation
vra00350  Tyrosine metabolism
vra00592  alpha-Linolenic acid metabolism
vra01100  Metabolic pathways
vra01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:vra00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    106765124
  09103 Lipid metabolism
   00071 Fatty acid degradation
    106765124
   00592 alpha-Linolenic acid metabolism
    106765124
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    106765124
Enzymes [BR:vra01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     106765124
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_zinc_N ADH_N Glu_dehyd_C ADH_zinc_N_2 AlaDh_PNT_C IlvN 2-Hacid_dh_C
Motif
Other DBs
NCBI-GeneID: 106765124
NCBI-ProteinID: XP_014505117
UniProt: A0A1S3UGF3
Position
6
AA seq 380 aa AA seqDB search
MSSTVGQTIKCKAAIAWEAGKPLVIEEVEVAPPQAGEVRLKILYTSLCHTDVYFWEAKGQ
TPLFPRIFGHEASGVVESVGEGVTHLQPGDHALPVFTGECGECVHCKSEESNMCELLRIN
TDRGVMINDGKSRFSKDGQPIHHFLGTSTFSEYTVLHAGCVAKINPAAPLDKVCVLSCGI
CTGLGATVNVAKPKPGSSVAIFGLGAVGLAAAEGARISGAKRIIGIDLVSDRFEEAKKFG
VNEFVNPKDHDKPIQQVIAEMTNGGVDRAVECTGSIQAMISAFECVHDGWGVAVLVGVPS
KDDAFKTAPINFLNERTLKGTFYGNYKPRTDLPGVVEKYLSGELEVDKFITHSVSFSEIN
KAFEYMLKGQSIRCLIRMQD
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcaaccgtgggccagacgatcaagtgcaaagctgccattgcatgggaggcaggg
aagccattggtgatcgaagaagtagaggtggcgccaccccaagccggggaagtccgtttg
aagatcctctacacctccctttgccacactgatgtttacttttgggaagccaagggccag
actccattgtttcctcgtatttttggccatgaagcttcaggtgttgttgagagcgttggc
gagggtgtcactcatttgcaaccaggagatcatgccctccctgtgttcacaggagagtgt
ggggaatgcgtacattgtaaatcagaagaaagcaacatgtgtgagctcctccggatcaac
accgataggggtgtaatgatcaatgatggtaaatcaaggttctctaaggatggacaaccc
atacaccatttcttgggaacctccacattcagtgaatacacagttctccatgcaggatgt
gttgcaaagatcaacccagctgctccacttgacaaagtttgtgttctcagttgtggaatt
tgcacaggtcttggtgctactgttaatgttgcaaaaccaaaacctggttcctctgttgct
attttcggacttggagccgttggccttgcggctgcagaaggggctaggatttccggtgct
aagagaatcattggaattgatttagtttcagatagatttgaagaagctaagaagtttggt
gttaacgagtttgtgaatccaaaggatcatgataaacctattcaacaggtaattgctgaa
atgaccaatggaggagtggaccgggctgttgaatgtactggcagcatccaggccatgatt
tctgcttttgaatgtgtccatgatggttggggtgttgctgtacttgttggtgtgcctagt
aaagatgatgcattcaaaactgctcctatcaatttcctgaatgagaggactcttaaagga
accttttatggtaactacaaaccacgcactgaccttcctggtgttgtggagaagtacctg
agtggggagctagaagtagataagttcatcactcactcagtttccttctcagagatcaac
aaagcctttgaatacatgctgaaaggacagtccattagatgtcttattcgcatgcaagac
tga

DBGET integrated database retrieval system