KEGG   Vigna radiata (mung bean): 106765751Help
Entry
106765751         CDS       T04126                                 

Definition
(RefSeq) autophagy-related protein 16
  KO
K17890  autophagy-related protein 16-1
Organism
vra  Vigna radiata (mung bean)
Pathway
vra04136  Autophagy - other
Brite
KEGG Orthology (KO) [BR:vra00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04136 Autophagy - other
    106765751
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:vra04131]
    106765751
   03029 Mitochondrial biogenesis [BR:vra03029]
    106765751
Membrane trafficking [BR:vra04131]
 Autophagy
  Autophagosome formation proteins
   Atg12 conjugation proteins
    106765751
 Others
  Rab GTPases of specific organelles
   Auto phagosome
    106765751
Mitochondrial biogenesis [BR:vra03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    106765751
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: WD40 ATG16 ANAPC4_WD40 Nup160 eIF2A Ge1_WD40 PQQ_2 PALB2_WD40 Cytochrom_D1 Phage_GP20 Cep57_CLD_2 UPF0242 V_ATPase_I zf-C4H2 Phlebovirus_NSM DUF2935
Motif
Other DBs
NCBI-GeneID: 106765751
NCBI-ProteinID: XP_014505962
UniProt: A0A1S3UIU5
Position
7
AA seq 514 aa AA seqDB search
MAKTNKSQEEIACEAIKHALKALRKRHLLEEAAHGPAVLALSRPFVSQGSEWKEKAENLQ
VELQQCYKAQSRLSEQLVVEVAESRASKALVQEKENAVADLQKELTELRDECSQLKEDLE
EKFKSLEVLVSENTELKAQLQQMTTKANKAEAENKMLIDRWMLEKMKDAERLNEANALYE
DMVEKLKASGLEQLARQQVDGIVRQSEEGAEFFLESNIPSTCKYRLRAHEGGCASMLFEY
NSSKLITGGQDRLVKMWDTNTGSLSSTLHGCLGSVLDLTITHDNRSVIAASSSNNLYVWD
VHSGRVRHTLTGHTDKVCAVDVSKISSRHVVSAAYDRTIKVWDLVKGYCTNTIIFHSNCN
ALSFSMDGQTIFAGHVDGNLRLWDIQSGKLLSEVAAHTSAVTSISLSRNGNFVLTSGRDN
LHNLFDVRSLEVCSTLKAAGNRVASNWSRSCFSPDDNHVAAGSADGSVYIWSISKGDIVG
TLKEHTSSVLSCTWSGIRKPLASADKNGVVCVWT
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaaacaaacaagtcgcaagaagaaattgcgtgtgaagctattaaacacgctttg
aaggcactgcggaagcgccatttgcttgaagaagccgctcatggtcccgctgttctagct
ctttctagaccctttgtttctcagggctctgagtggaaagagaaagcagagaatcttcaa
gtggaacttcagcaatgctacaaagctcaatctcggctgtctgagcaacttgttgtggaa
gtagctgagtccagagcttcaaaagcgttggttcaagagaaagaaaatgcagttgctgat
ttgcaaaaggaattgactgaattgagggatgagtgctctcaattaaaggaagacttggaa
gaaaagtttaaatctctagaagtgcttgtcagtgagaatactgaacttaaagcccaactg
cagcagatgactactaaagcaaataaagctgaagctgagaataagatgttgattgaccgc
tggatgttggaaaagatgaaggatgctgaacgcctaaacgaggctaatgcactgtacgaa
gacatggtcgagaagctaaaggccagtggcttagagcaacttgcaaggcagcaggtggat
ggtatagttcgccaaagtgaagaaggtgctgagttttttttagagtcaaacattccttcc
acatgtaaatacaggcttcgtgcacatgaaggtggttgtgcttccatgttgtttgagtac
aattccagtaaattgattactgggggacaggatcggttagttaaaatgtgggatacaaat
accggatccttatcttctactcttcatggctgccttggctcagtattagatctcactatc
acccatgataaccgatctgtcattgctgcaagcagctcgaacaacttgtatgtatgggat
gtccactcaggccgtgtccgtcatacccttactggccacacagataaagtttgtgctgtt
gatgtgagcaagatttcaagtcgtcatgttgtcagtgctgcttatgatcgtaccataaaa
gtttgggacctagtgaaaggttactgcaccaacacaatcatttttcacagcaactgcaat
gctctctccttcagcatggatggtcagaccatatttgcaggacatgttgatggtaatctt
cggttatgggacattcagagcggaaagctactcagcgaggttgctgcacatacatctgca
gttacatcaatatccctttctcgaaatggaaattttgtactgaccagtggaagggacaat
ttgcacaatttgtttgacgtgcgatctcttgaagtttgtagcacactaaaagcggcagga
aacagagttgcttctaactggagtcgctcctgttttagtccagatgacaatcacgttgct
gctgggtctgccgatggatctgtgtatatttggtcaatttctaaaggtgatatagtcggt
acgctcaaggaacacacttcttctgttctgtcttgtacgtggagcggcatcagaaaaccc
ctagcttcagctgacaagaatggggtagtttgtgtctggacataa

DBGET integrated database retrieval system