KEGG   Vigna radiata (mung bean): 106766126Help
Entry
106766126         CDS       T04126                                 

Definition
(RefSeq) uncharacterized protein LOC106766126
  KO
K05349  beta-glucosidase [EC:3.2.1.21]
Organism
vra  Vigna radiata (mung bean)
Pathway
vra00460  Cyanoamino acid metabolism
vra00500  Starch and sucrose metabolism
vra00940  Phenylpropanoid biosynthesis
vra01100  Metabolic pathways
vra01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:vra00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    106766126
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    106766126
  09110 Biosynthesis of other secondary metabolites
   00940 Phenylpropanoid biosynthesis
    106766126
Enzymes [BR:vra01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.21  beta-glucosidase
     106766126
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_3 Glyco_hydro_3_C
Motif
Other DBs
NCBI-GeneID: 106766126
NCBI-ProteinID: XP_014506368
UniProt: A0A1S3UK04
Position
7
AA seq 629 aa AA seqDB search
MAKVRIFLMGLLMLLHCCVATNEAKYLKYKDPKQPLNVRIKDLMDRMTLEEKIGQMTQIE
RKVASAEIMNNYYIGSVLSGGSSVPKPQASAEDWIKMVNDFQKGSLSTRLGIPMIYGIDA
VHGNNNVYNATIFPHNVGLGATRDPKLVRRIGAATALEVRATGIQYVFAPCIAVCRDPRW
GRCYESYSEDHKVVQAMTEIIPGLQGDIPANSQKGVPYVAGKRKVIASAKHYVGDGGTIK
GINENNTVISRHGLLSIHMPAYYNAIIKGVSTVMVSYSSWNGEKMHANRNLITDFLKNSL
RFRGFVISDWKGIDKITTPPHANYTYSIYAAITAGIDMVMVPFNYTEFIDGLTLLVKSNA
IPMSRINDAVRRILRVKFVAGLFENPLADYNLVHHLGRKKHRELAREAVRKSLVLLKNGE
NPKQPVLPLPKRASKVLVAGSHADNLGYQCGGWTIEWQGVTGNNVTKGTTILSAIKNTVD
KDTEVVYKENPDLDYVKSNNFSYGIVVVGEKPYAETKGDSLNLTISAAGPETIKNVCGGV
KCVTVIISGRPLVIEPYVEKIDALVAAWLPGTEGNGVTDVLFGDYGFRGKLPRTWFKSVD
QLPMNVGDTHYDPLFPFGFGLKTKPHKYS
NT seq 1890 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaagtcagaatctttctgatggggctacttatgctcttgcattgttgtgttgcc
acaaatgaagcaaagtatttgaaatataaagatccaaaacaacctctgaatgttcgaatc
aaggatctcatggacagaatgactttagaggagaaaattggtcagatgacacagattgaa
cgtaaagttgcttctgcagaaatcatgaacaactattatattgggagtgtgctaagtggg
ggaagcagtgttccaaagccacaagcttctgcagaggattggataaaaatggtgaatgat
tttcaaaaaggttctttatcaactagattgggaattcctatgatatatgggatagatgct
gttcatggcaataataatgtatataatgcaacaatttttcctcacaatgttgggttaggt
gctaccagagatcctaaactagtgaggagaattggagcagcaactgctctggaagttaga
gctactggaattcaatatgtttttgcaccttgcatagcggtttgtagagatcccaggtgg
ggaagatgttatgaaagttatagtgaagaccataaagtagttcaagctatgactgagatc
attccaggtctacaaggtgatatcccagcaaactcccaaaagggtgttccatatgttgct
ggaaagcgaaaagttatagcctctgcaaagcattatgttggggatggaggaactataaag
ggaatcaatgagaacaacacagtgataagcagacatggattgcttagcattcacatgcca
gcctattataatgcaatcatcaagggtgtttccactgtcatggtctcttattcaagctgg
aatggagaaaagatgcatgccaatcgtaatctaatcacagactttctcaaaaactcatta
cgctttaggggttttgtcatatcagattggaaggggattgataagatcactacacctcct
catgctaactacacatattccatttatgctgcaatcactgctggaattgacatggtaatg
gttccctttaattacacagaattcatagatggcttaaccttattggtgaaaagtaatgcc
ataccaatgagccgaattaatgatgcagtaaggagaattttaagggtaaagtttgttgca
ggcctttttgagaatccgttggctgattataacctagttcaccatcttgggaggaagaaa
catagagaattggctcgggaagctgtgaggaaatccttggttttattgaagaatggtgaa
aaccctaaacaaccagttctccctcttcctaaaagggcttcaaaggtactagttgctgga
agccatgctgataatctaggatatcaatgtggtggttggaccatcgaatggcaaggagtt
actggaaataatgtcaccaaaggtacaacaatcctcagtgctatcaaaaacacggttgat
aaagatactgaggtagtgtacaaggagaatcctgatttggactatgtgaagtctaataat
ttttcatatggcattgtggtagttggagagaaaccatatgctgaaacaaaaggtgatagc
ttgaatttgacaatctctgcagctgggccagaaaccataaaaaatgtgtgtggaggagtg
aagtgtgttactgtgataatctctggtcgtcctttggttatagaaccatatgttgagaaa
attgatgctctggttgctgcttggcttcctggtactgagggaaatggtgtgactgatgtt
ttgtttggtgactatggttttagaggaaagcttccaaggacatggttcaaaagtgttgat
cagttaccaatgaatgttggagatactcattatgaccctcttttcccctttgggtttggc
cttaaaaccaaaccccacaaatacagttag

DBGET integrated database retrieval system