KEGG   Vigna radiata (mung bean): 106768402Help
Entry
106768402         CDS       T04126                                 

Definition
(RefSeq) acyl-coenzyme A oxidase 2, peroxisomal
  KO
K00232  acyl-CoA oxidase [EC:1.3.3.6]
Organism
vra  Vigna radiata (mung bean)
Pathway
vra00071  Fatty acid degradation
vra00592  alpha-Linolenic acid metabolism
vra01040  Biosynthesis of unsaturated fatty acids
vra01100  Metabolic pathways
vra01110  Biosynthesis of secondary metabolites
vra01212  Fatty acid metabolism
vra04146  Peroxisome
Module
vra_M00087  beta-Oxidation
vra_M00113  Jasmonic acid biosynthesis
Brite
KEGG Orthology (KO) [BR:vra00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    106768402
   00592 alpha-Linolenic acid metabolism
    106768402
   01040 Biosynthesis of unsaturated fatty acids
    106768402
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    106768402
Enzymes [BR:vra01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.6  acyl-CoA oxidase
     106768402
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ACOX Acyl-CoA_dh_M Acyl-CoA_dh_1 Acyl-CoA_dh_N
Motif
Other DBs
NCBI-GeneID: 106768402
NCBI-ProteinID: XP_014509033
UniProt: A0A1S3USG3
Position
7
AA seq 687 aa AA seqDB search
MQIPNSKLNSDSEPVSEAERRIQRLALHLSPVACVAARQLEMEACGGRGKLSVDTPSLSS
YMRGKQRDIQEKVFDYFNANPHLQTPVEILKDDHRELCMKQLTGLVREAGIRPLRYVVND
PTKYFAILEAVGSIDMSLGIKMGVQYSLWGGSVLNLGTKKHKDKYFDGIDNLDYPGCFAM
TELHHGSNVQGLQTVATFDVITDEFIIDTPNDGAIKWWIGNAAVHGKFATVFARLKLPTY
DTKGVTDMGVHAFIVPIRDMKTHQPLPGIEIHDCGHKVGLNGVDNGALRFRSVRIPRDNL
LNRFGDVSRDGKYTSSLPTVNKRFAATLGELVGGRVGLAYSSVSVLKVSATIAIRYSLLR
QQFGPPNQPEVSILDYQSQQHKLMPMLASTYAFHFATTTLVEKYSQMKKTHDEELVADVH
ALSAGLKAYITSYTAKSLSICREACGGHGYAAVNRFGVLRNDHDIFQTFEGDNTVLLQQV
AADLLKQYKGKFKGGTFAVTWNYLRESMNTYLSQPNPVTVRWEGEDHLRDPNFQLDAFRY
RTSRLLQSVAVRLRKHSKSLGDFGAWNRCLNHLLTLAESHIESVILAKFIESVQSCPDPS
SQAALKLVCDLYALDRIWNDIGTYRNVDYVAPNKAKAIHKLTEYLCFQVRNVARELVDAF
DLPDHVTRAPIAMRSGAYSQYTQHVGF
NT seq 2064 nt NT seq  +upstreamnt  +downstreamnt
atgcaaattccaaactccaaactcaactccgactccgagccagtctccgaagcagagcgg
cgaatccagaggctggcgctgcacctgagccccgtcgcgtgcgtggcggcgaggcagttg
gagatggaagcgtgcggcgggcgtgggaagctgagcgttgacaccccatctctatcgagt
tacatgcgaggtaagcaaagggacattcaagagaaggtgttcgattacttcaacgccaat
ccgcaccttcaaacgcccgttgagatcttgaaagacgaccatcgagaattgtgcatgaag
cagttaacgggactcgtcagagaagcggggattcgaccccttcgttacgtagtcaacgat
cccaccaagtacttcgccatcttggaagccgttggaagcattgacatgtcgctcgggatc
aagatgggggtccagtacagtctttggggtggttctgttctgaatttggggacaaagaag
cataaggataagtactttgatgggattgataacttggactatcccggttgttttgctatg
accgagcttcaccatggttcaaacgtgcagggcctccaaactgttgccacctttgatgta
atcactgatgaatttatcattgacacaccaaatgatggtgccatcaaatggtggattggc
aatgctgcagtgcatggaaagtttgccactgtttttgctaggttgaaattacccacttat
gacaccaaaggagttactgatatgggtgtccatgctttcatagttccaataagggatatg
aagacccatcaaccacttcctggaattgagatacatgattgtggccataaagttggcctc
aatggtgtggataatggagcattgagattccgctcggtaagaattcctcgtgacaatctt
ctaaaccgttttggagatgtctcccgtgatggaaaatacacgagtagtcttcctacagta
aataagcgatttgctgcaactctaggtgaacttgttggtggtagggtaggccttgcatat
tcttcagtaagtgtcctgaaggtttcggccacaattgccatcagatattctctacttcgt
cagcaatttggacctccaaaccaacctgaagttagtattcttgattaccagtctcaacag
cacaagcttatgccaatgcttgcttctacatatgcttttcattttgcaacaacaacttta
gtggagaaatactctcaaatgaaaaaaactcatgatgaagaattagttgcagatgtccat
gctctatcagctggtctaaaggcttatataacatcctatactgcaaagtcactcagcatc
tgtagggaagcctgtggaggtcatggttatgctgctgtaaaccggtttggtgttttgagg
aacgatcatgatatttttcagacatttgaaggagacaacacggttctactacaacaggtt
gcagctgatcttttgaaacaatacaagggaaagttcaaaggaggaacttttgcagtgaca
tggaactacttgagagaatccatgaatacatatctatcacagccaaatccggtaactgtt
aggtgggaaggcgaagatcatttacgggatcctaattttcaattggatgccttcagatat
cgaacgtctagattacttcagagtgttgctgtgcgactccgaaagcattctaaatccctt
ggggactttggtgcatggaatagatgtttaaatcaccttttgacacttgcggagtcgcat
attgaatcagtcatccttgctaaattcattgaatctgtgcagagctgtcccgatccaagc
tcgcaagctgctctgaagctcgtctgtgatctctatgctctggatcgaatatggaatgac
attggaacctaccgaaacgttgactatgtggctcctaacaaagctaaggcaatccacaaa
cttacggagtatctctgtttccaagtgaggaatgttgcaagggaacttgttgatgcattt
gatcttccggatcatgttactcgggcccctattgccatgcggtcaggagcttactcgcag
tacacacaacatgtgggattttaa

DBGET integrated database retrieval system