KEGG   Vigna radiata (mung bean): 106769598
Entry
106769598         CDS       T04126                                 

Definition
(RefSeq) delta(14)-sterol reductase
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
vra  Vigna radiata (mung bean)
Pathway
vra00100  Steroid biosynthesis
vra01100  Metabolic pathways
vra01110  Biosynthesis of secondary metabolites
Module
vra_M00917  Phytosterol biosynthesis, squalene 2,3-epoxide => campesterol/sitosterol
Brite
KEGG Orthology (KO) [BR:vra00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    106769598
Enzymes [BR:vra01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     106769598
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295
Other DBs
NCBI-GeneID: 106769598
NCBI-ProteinID: XP_014510768
UniProt: A0A1S3UXE9
Position
8
AA seq 373 aa
MESNVDLGFLLHALMPSWNSVPLLTGFFSYLAIAGSILPGKIVPGVALPDATRLHYRCNG
LLSLLLLVALLGIGTNMGFVSPTAISDRGLELLSTTFLFSFLVTLVLYFSGCESQSKGSS
LKPHISGNLIHDWWFGIQLNPHFMGIDLKFFFVRAGMMGWLLINLSILMKSIQDGTLSQS
MILYQLFCALYILDYFVHEEYMTSTWDIIAERLGFMLVFGDLVWIPFTFSIQGWWLLKNN
VDLTTAAMVANCFVFLIGYMVFRGANKQKHVFKKNPKAPIWGKPPKVVGGKLLASGYWGV
ARHCNYLGDLLLALSFSLPCGISSPIPYFYPVYLLILLIWRERRDETRCAEKYKEIWAEY
RKLVPWRILPYVY
NT seq 1122 nt   +upstreamnt  +downstreamnt
atggagtcgaacgtggatctgggttttctcctacacgctctcatgccatcttggaactcc
gttcctttgcttacggggttcttcagttacttggccattgctggatccattctccctgga
aaaattgttcctggggttgctctacctgatgcaactcgtcttcactatcgctgcaatggt
ctgctctcgcttcttctgttggttgcgcttcttgggatcggtaccaatatgggttttgtg
tctcccactgccatatcagacagaggacttgaattgctgtccacgacgtttctctttagt
tttcttgtgactctggtattgtatttttctggttgcgagtcacaaagtaaaggttcatct
ctaaaacctcatatcagtgggaacctgatacatgattggtggtttggaatacaactaaat
cctcacttcatgggtattgacctcaaatttttctttgttagagctggaatgatggggtgg
ctacttatcaatttatctattcttatgaagagcattcaagatggtactttgagccagtca
atgattctctaccagctattctgtgcactatacatcctggactattttgtacatgaagaa
tacatgacatccacctgggacataattgcagagagattgggcttcatgttggtgtttgga
gatttagtgtggatacctttcactttcagcatacaggggtggtggctattgaagaacaat
gtggacttaacaacggctgccatggtagctaattgctttgtcttcttgatcggatatatg
gtatttcgaggggcaaacaagcaaaaacacgtgttcaaaaagaatccaaaggctcctatt
tggggtaagcctccaaaagttgttggaggcaagctactagcgtctggttattggggtgtt
gctaggcactgtaattacctaggggatttgcttcttgctctctcctttagcttaccttgt
gggataagttccccaattccatacttctatccagtttatcttcttattctgttgatctgg
agagagagaagggatgaaactcgttgtgcagagaagtataaagagatatgggcagagtat
cgtaaacttgttccatggagaatattgccttatgtttattag

DBGET integrated database retrieval system