KEGG   Vigna radiata (mung bean): 106772331Help
Entry
106772331         CDS       T04126                                 

Definition
(RefSeq) probable pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH5
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
vra  Vigna radiata (mung bean)
Pathway
vra03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:vra00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    106772331
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:vra03041]
    106772331
Enzymes [BR:vra01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     106772331
Spliceosome [BR:vra03041]
 Complex C
  Other components
   Step II factors
    106772331
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HA2 OB_NTP_bind Helicase_C DEAD AAA_22 AAA_19 AAA_30 T2SSE AAA DUF2075 Sigma54_activ_2 AAA_14 Flavi_DEAD PhoH ABC_tran AAA_16 AAA_33
Motif
Other DBs
NCBI-GeneID: 106772331
NCBI-ProteinID: XP_014514179
UniProt: A0A1S3V7R2
Position
8
AA seq 721 aa AA seqDB search
MLDTIPKDLNRPWEDPMPESGERHLAQELRGVGLSAYDMPEWKKDAYGKTITFGQRSKLS
IQEQRQSLPIYKLKKELIQAVXDNQVLVVIGETGSGKTTQVTQYLAEAGYTTKGKIGCTQ
PRRVAAMSVAKRVAEEFGCRLGEEVGYAIRFEDCTGPDTVIKYMTDGMLLREILVDENLS
QYSVIMLDEAHERTIHTDVLFGLLKQLVKRRPKLRLIVTSATLDAEKFSGYFFNCNIFTI
PGRTFPVEILYTKQPESDYLDASLITVLQIHLTEPEGDILLFLTGQEKIDFACQSLYERM
KGLGKNVPELIILPVYSALPSEMQSRIFEPAPPGKRKVVVATNIAEASLTIDGIFYVIDP
GFAKQNVYNPKLGLDSLVITPISQASAKQRAGRAGRTRPGKCYRLYTESAYRNEMSPTTI
PEIQRINLGMTTLNMKAMGINDLLSFDFMDPPSPQALISAMEQLYSLGALDEEGLLTKLG
RKMAEFPXDPPLSKMLLASVDLGCSDEILTIIAMIQTGNIFYRPREKQAQADQKRAKFFQ
PEGDHLTLLAVYEAWKAKNFSGPCCFENFVQSRSLRRAQDVRKQLLTIMDKYKLDVVSAG
RNFTKVRKTITAGFFFHAARKDPQEGYRTLVENQPVYIHPSSALFQRQLDWVIYHELVMT
TKEYMREVTVIDPKWLVELAPRFFKVADPTKMSKRKRQERIEPLYDRYHEPNSWRLSKRR
A
NT seq 2166 nt NT seq  +upstreamnt  +downstreamnt
atgcttgatacaattccgaaggatctcaatcggccttgggaagaccctatgccagagtca
ggtgaaaggcatcttgcccaggagcttaggggtgttggtttatcagcctatgatatgcca
gaatggaagaaggatgcatatgggaaaacaattacctttgggcaaaggtcgaagctttct
attcaagagcagaggcagagtttgccaatttacaagttaaaaaaagaattgattcaggct
gtgnatgataatcaggtgttggttgttattggagaaactggttcgggtaagactactcag
gtcacacagtatcttgccgaagcaggttataccacaaaaggaaaaattggatgtactcaa
cctcgtagggtggctgcaatgtcagttgcaaagagagtagcagaagagtttggttgtaga
ttgggagaagaagttggttatgccattcggtttgaggattgcactggaccagatactgtt
atcaagtacatgacagatggtatgcttcttagggaaatattggtagatgagaatctgtca
cagtattctgttataatgcttgacgaagcccatgaaagaactattcatactgatgttctt
tttggactgctcaagcagctagtgaagcgaagacccaaattgcgattgattgtcacttct
gctactctggacgccgagaaattttcaggatatttctttaactgtaacatctttacaatt
cctggtagaacttttcctgtagagatactttataccaaacagccggaaagtgattattta
gatgcatctttaataactgtcctacagatacacttgacagagcccgagggagacattctt
ctctttttgactgggcaagagaagattgattttgcttgccaatctctatacgagagaatg
aagggattaggtaagaatgttccagagctgatcattttaccggtttatagtgcccttcct
agtgaaatgcagtctaggatatttgaacctgctcctccagggaaaaggaaagtggtcgtg
gctactaacattgccgaggcttctttgactattgatgggatattttatgtaattgatcct
ggatttgctaagcaaaatgtttataacccaaagctaggtcttgattctttggtaataact
ccaatttcacaagcatcagccaaacaaagagctggacgtgcagggcgtactcgacctggg
aagtgttatcgcctttacactgagagtgcatacaggaatgagatgtctcccactacaatt
cctgagattcaaaggataaatctggggatgactacacttaatatgaaagcaatggggata
aatgatctactgtcctttgattttatggatccaccatcacctcaagcactgatttctgcc
atggagcagctttacagtctaggagcattggatgaagagggccttctgaccaaattgggg
aggaaaatggcagaatttccttnggatccacctttgtccaagatgttgcttgccagcgtc
gaccttggatgcagtgatgagattttaaccataattgccatgatccagactggtaatatt
ttttacaggccaagggaaaagcaagcccaagcagatcagaagagggcaaagtttttccag
ccagagggtgatcatctgacactacttgctgtttatgaggcttggaaagccaagaatttt
tctgggccctgctgttttgagaattttgtgcaatctagatcgttgagaagagcacaggat
gtcaggaaacaacttctcaccattatggataagtacaaattggatgttgtaagtgctgga
agaaacttcaccaaagtaaggaagactatcactgctggtttcttttttcacgctgccaga
aaggatccccaggaaggatacagaactctagttgagaaccaacctgtgtatatccatcca
agttctgctttgttccagaggcagctagactgggtcatatatcatgagcttgtgatgaca
actaaggagtatatgcgtgaggtgactgtcatagaccccaaatggcttgttgaactggct
ccaagatttttcaaagtagcagatcctacaaagatgagcaagcggaagcgtcaagagcga
attgagccactttatgatagataccacgagccaaattcatggcgtttgagtaaacgtcgt
gcatga

DBGET integrated database retrieval system