KEGG   Vigna radiata (mung bean): 106774801Help
Entry
106774801         CDS       T04126                                 

Definition
(RefSeq) probable mediator of RNA polymerase II transcription subunit 37c
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
vra  Vigna radiata (mung bean)
Pathway
vra03040  Spliceosome
vra04141  Protein processing in endoplasmic reticulum
vra04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:vra00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    106774801
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    106774801
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    106774801
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:vra01009]
    106774801
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:vra03041]
    106774801
   03009 Ribosome biogenesis [BR:vra03009]
    106774801
   03110 Chaperones and folding catalysts [BR:vra03110]
    106774801
   04131 Membrane trafficking [BR:vra04131]
    106774801
   03051 Proteasome [BR:vra03051]
    106774801
   03029 Mitochondrial biogenesis [BR:vra03029]
    106774801
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:vra04147]
    106774801
Protein phosphatases and associated proteins [BR:vra01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     106774801
Spliceosome [BR:vra03041]
 Complex B
  Other components
   Prp19 complex
    106774801
 Complex C
   Prp19-CDC5 complex
    106774801
Ribosome biogenesis [BR:vra03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    106774801
Chaperones and folding catalysts [BR:vra03110]
 Heat shock proteins
  HSP70 / DNAK
   106774801
Membrane trafficking [BR:vra04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    106774801
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    106774801
Proteasome [BR:vra03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    106774801
Mitochondrial biogenesis [BR:vra03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    106774801
Exosome [BR:vra04147]
 Exosomal proteins
  Proteins found in most exosomes
   106774801
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C Peptidase_M32 DUF2540 TBCA
Motif
Other DBs
NCBI-GeneID: 106774801
NCBI-ProteinID: XP_022642969
UniProt: A0A3Q0FJW9
Position
10
AA seq 438 aa AA seqDB search
MPLAKSTIDAGTIAGLNIIRIINEPTAAAIAYGLDRRINNCGKIFEVKATAGNTHLGGED
IDNRMVNYFLEKIKKEKKVDISGNPKALRRLRSACERAKRTLSHAVSARIEVDGLSNGID
FCSSITRARFEEINMELFKQCMETVDRCLADAKMDKRSMHDIVLVGGSSRIPKVQELLQD
FFEGKDLCKSINPDEAVAYGAAVQAALLSVGIKNVPDVVLLDVIPLSLGINIKGDIMSVM
IPRNTTIPVKRTHTYFTSADNVSSVRIKVYEGERTRSSDNNLLSSFNLSGFPKAPRGHPF
DVCFAIDENGILSVSAKEETTGISNKIIITNDIERLPTEEINRMIQEAEVYKAKDMKFLR
KAKTMNKIDDYAYKIKKALEKENYSSKVCSEDRKKISSAITKATELLDGGQQEEEIEVFE
DHLEELINLFERFGGKSG
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgcctttggccaagtctaccatagatgctggaaccattgctggccttaacatcatacgg
ataatcaacgaaccaactgctgcagctattgcatatggtcttgacagaaggattaataat
tgtggtaagatctttgaagttaaggcaacagcgggaaacactcaccttggaggagaggac
attgataacagaatggtgaactactttctggagaaaataaagaaggaaaagaaagtggac
attagtggaaatcctaaagcattaaggaggttgagaagtgcctgtgagagggccaaaagg
acactgtcacatgctgtcagtgccagaattgaggtagatggtttatctaatggcattgac
ttttgttcttcnatcactcgtgcaagatttgaggaaatcaacatggagctctttaaacag
tgtatggagacagtagataggtgtcttgctgatgcaaaaatggacaagagaagtatgcat
gatattgttcttgttggtgggtcttctaggattcccaaagtgcaagaattattgcaagat
ttctttgagggtaaggatctgtgcaaaagcataaaccctgatgaagctgtagcctatggt
gctgctgtgcaggctgctttgttgagtgtaggtattaagaatgttcctgacgtggtgttg
ctggatgtaataccgttatcacttggtattaatataaagggagatatcatgagtgtaatg
attccaaggaatactactattcctgtaaagaggacacatacatattttactagtgcagat
aacgtatcatctgttcgaataaaggtttatgagggtgagagaacaagatccagtgataac
aatttgttgagctctttcaatctttctggctttcctaaagctcctaggggccatcctttt
gatgtgtgctttgccatagatgaaaacggtatactatctgtctctgctaaggaagaaaca
actggcatcagcaataagatcatcataaccaatgacatagaacgattgccaacggaagaa
attaatagaatgattcaagaagcagaggtatacaaagctaaagatatgaaattccttagg
aaggccaaaacaatgaataaaattgatgactatgcttacaagataaagaaagctttggaa
aaagagaattacagttcaaaagtttgctcagaagacaggaaaaagatcagttctgcaata
actaaggccacagagttacttgatggtggtcagcaggaggaggaaatagaagtgtttgag
gatcatctggaagagcttattaacctctttgaacgttttggtggaaagtctggttag

DBGET integrated database retrieval system