KEGG   Vigna radiata (mung bean): 106776102Help
Entry
106776102         CDS       T04126                                 

Definition
(RefSeq) multiple inositol polyphosphate phosphatase 1 isoform X1
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
vra  Vigna radiata (mung bean)
Pathway
vra00010  Glycolysis / Gluconeogenesis
vra00562  Inositol phosphate metabolism
vra01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vra00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    106776102
   00562 Inositol phosphate metabolism
    106776102
Enzymes [BR:vra01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     106776102
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     106776102
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2 Ndc80_HEC
Motif
Other DBs
NCBI-GeneID: 106776102
NCBI-ProteinID: XP_014518911
UniProt: A0A1S3VKM2
Position
10
AA seq 494 aa AA seqDB search
MSNSIMAFALLLFLWLIGYSNAEEAFDVRKHLSTVSRYGAVKDIADSNFVPSKIPEGCVP
IHLNLVARHGTRSPTKKRIKKLDNLSAHLEDLVRDAKERNLPLERVPSWLNGWKSPWQGR
LTGGELISKGEEELYDLGIRIRAKFPNLFDEEYHPDVYPIKTSQIPRASASAVAFGMGLF
RGNGSLGPERHRAFAVTSESRASDIQLRFHDCCHNYKAYRKNQEPAVSKLKEPILDEITS
ALIGRHYLNFTREDTSSLWFLCKQEASLLDITNQACGLFIPSEIELLEWTDDLEMFILKG
YGNSLNYRMGVPLLEDVFQSMEQAIIAKEGKHASGSFEKARLRFAHAETLVPFSCLLGLF
LEGSEIKKIQKEQPLQQPPMPPQKRKWRGSTVAPFAGNNMLVLYSCSAPDKSTSKHFVQV
LHNEHPIPLPGCDGSDLCPFELFKEKIVAPHQKHDYHTVCNPKLEHEPSGSKFFQIFQWL
FSSAKGDNYSKDEF
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgagcaattctatcatggcctttgctctgctattattcctttggttgataggctattca
aacgccgaagaagctttcgatgttcgcaagcacctctccactgtctctagatatggtgcc
gtgaaagacattgctgacagtaacttcgttccttctaaaatccccgagggatgtgttccg
atccatttgaatcttgtggctaggcatggaactcgttctcccacgaagaaaaggataaag
aagttagataatttgtctgctcatctggaagatcttgtgagggatgcaaaagagcgaaat
ttgcctttggagagggttccttcctggctgaatggatggaaatctccttggcagggaagg
cttacgggtggtgaattaattagcaaaggagaggaagaattatatgatcttggaatcagg
attagagccaagtttccaaatttgtttgatgaagaataccatcccgacgtctatcctatt
aagacatctcagattccccgagcgtctgccagtgctgtggcatttggtatggggcttttc
agaggcaatggaagtcttggacctgagcgtcatcgagcctttgctgttacaagtgaaagc
cgtgctagtgacatacagctgagatttcatgactgctgtcataattacaaggcttatcgg
aaaaaccaggaacctgcagttagtaaacttaaggaacccattttggatgagattacatct
gcactgattggacgccattaccttaattttactagggaggatacatcttctctctggttt
ttgtgtaaacaggaggcatccttgttggatataactaatcaagcgtgtggtcttttcatc
ccttctgagattgaattgcttgagtggacagatgatttggagatgtttattctgaaaggt
tatggtaactcactaaactatagaatgggagtgccattacttgaagatgtttttcaatcc
atggaacaggctatcatagctaaagaaggaaaacatgcttctggcagctttgaaaaggca
agacttcggtttgcgcatgctgaaaccttagttccattttcatgtctccttggtttattt
cttgaaggatctgagattaaaaaaattcagaaggaacaacctctacagcagcctccaatg
cctccacagaaaagaaaatggcggggtagcactgtagccccttttgctggtaacaacatg
ctggtcttgtatagttgttctgctccagataaatctacaagcaagcactttgtgcaggtg
ttacacaatgaacaccccattccattgccaggttgtgatggctctgatctctgcccattt
gaactattcaaggaaaaaatagttgcaccacatcagaagcatgactaccatacggtctgt
aatccaaagctagagcatgagccctcgggcagcaagttttttcagatatttcagtggctt
ttctcatcagcgaaaggtgataactactcgaaagatgaattttag

DBGET integrated database retrieval system