KEGG   Vigna radiata (mung bean): 106777641Help
Entry
106777641         CDS       T04126                                 

Definition
(RefSeq) phosphoenolpyruvate carboxykinase (ATP)
  KO
K01610  phosphoenolpyruvate carboxykinase (ATP) [EC:4.1.1.49]
Organism
vra  Vigna radiata (mung bean)
Pathway
vra00010  Glycolysis / Gluconeogenesis
vra00020  Citrate cycle (TCA cycle)
vra00620  Pyruvate metabolism
vra00710  Carbon fixation in photosynthetic organisms
vra01100  Metabolic pathways
vra01110  Biosynthesis of secondary metabolites
vra01200  Carbon metabolism
Module
vra_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
vra_M00170  C4-dicarboxylic acid cycle, phosphoenolpyruvate carboxykinase type
Brite
KEGG Orthology (KO) [BR:vra00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    106777641
   00020 Citrate cycle (TCA cycle)
    106777641
   00620 Pyruvate metabolism
    106777641
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    106777641
Enzymes [BR:vra01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.49  phosphoenolpyruvate carboxykinase (ATP)
     106777641
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PEPCK_ATP AAA_33
Motif
Other DBs
NCBI-GeneID: 106777641
NCBI-ProteinID: XP_014520789
UniProt: A0A1S3VRV3
Position
11
AA seq 658 aa AA seqDB search
MASNGNGSVANGNGTAKNGLAKIQTQKKHNGICHDDSVPTVKAQTIDELHSLQRKRSAPT
TPVTGSQAPFATLSEEDRHKQQLQSISASLASLTRETGPQLVKGDPARKADTKVTHVHHH
VIPTIAVSDSALKFTHVLYNLSPAELYEQAIKYEKGSFITATGALATLSGAKTGRSPRDK
RVVKDDLTENELWWGKGSPNIEMDEHTFMVNRERAVDYLNSLDKVFVNDQFLNWDPENRI
KVRIVSARAYHSLFMHNMCIRPTPEELENFGTPDFTIYNAGQFPCNRYTHYMTSSTSIDL
NLSRKEMVILGTQYAGEMKKGLFSVMHYLMPRRQILSLHSGCNMGKNGDVALFFGLSGTG
KTTLSTDHNRYLIGDDEHCWGENGVSNIEGGCYAKCIDLSREKEPDIWNAIRFGTVLENV
VFDEHDRDVDYSDKSVTENTRAAYPIEYIPNAKLPCVGPHPKNVILLACDAFGVLPPVSK
LNLAQTMYHFISGYTALVAGTEDGIKEPQATFSACFGAAFIMLHPTKYAAMLAEKMQKHG
ATGWLVNTGWSAGSYGQGSRIKLQYTRKIIDAIHSGSLLNAEYKKTEIFGLEIPTEVEGV
PSEILDPVNTWSNKKAYKETLLKLAGLFKNNFETFTSHKIGKGNNNLTEEILAAGPIF
NT seq 1977 nt NT seq  +upstreamnt  +downstreamnt
atggcgtccaacggaaatggcagcgttgcaaacggtaacgggacagctaagaacggactg
gccaagattcagacacaaaagaagcataacgggatttgtcacgacgacagcgttcccacc
gtgaaggcgcagaccattgacgagcttcactcgctgcagaggaagaggtctgcacccacc
acacccgttacggggtctcaggctcccttcgccaccctttcggaggaagatcgtcataag
cagcaactccagtccatcagtgcatctctggcgtcactgaccagagaaacgggaccgcaa
ctggtgaagggagacccagctaggaaggcagataccaaggttactcacgtgcaccatcat
gtcattcccaccattgctgtcagcgacagtgctttgaaatttacccatgtcctctacaat
ctctcccctgctgaactttacgagcaagcgatcaagtatgagaaaggatcattcatcact
gccacgggggcattggcaacactttcaggggccaagacaggtcgctctccgagggacaag
cgcgtcgtcaaggacgatctcactgagaatgagctttggtggggaaagggttcccctaac
atcgagatggacgagcacactttcatggtgaacagagagagagccgttgattacttgaac
tccttggacaaggtgttcgtgaatgaccaattcttgaactgggacccggagaacagaatc
aaagtccggattgtgtctgcgagagcttaccattcattgttcatgcacaacatgtgtatc
cgtcccactcccgaagagctggagaattttggtactccggacttcactatttacaatgct
ggacagttcccgtgtaaccgttatactcactacatgacatcctccactagcatagatcta
aatctttctaggaaggaaatggtcatcctcggcacacaatacgccggggaaatgaagaag
ggtcttttcagtgtcatgcattatctcatgcctaggcgtcaaatcctctcccttcactct
ggatgcaacatgggcaaaaatggggatgttgctctcttctttggactctcaggtactgga
aagaccactctttctaccgaccataataggtacttgatcggtgatgatgaacactgttgg
ggtgagaatggtgtctccaacattgaaggtggttgctatgccaaatgcattgatctctcc
cgggagaaggaacctgatatttggaatgcaatcaggtttggcacagtgttggaaaacgtg
gtgtttgatgagcatgatcgcgatgttgattactctgacaaatcggttaccgaaaatact
cgtgctgcttatcccattgaatacattccaaatgcaaagttaccttgtgttggtcctcac
ccaaagaatgtcatacttttggcatgtgatgcatttggtgtactaccacctgtgagcaag
ttgaacctggcccagaccatgtaccatttcatcagcggatatactgctttggtggctggc
acagaggacggtataaaggagccacaggcaacattctcggcttgttttggtgcagcattt
attatgctacaccctacaaaatatgcagcaatgcttgctgaaaagatgcagaaacacggt
gctaccgggtggcttgttaacactggttggtctgctggcagctatggtcaagggagtcgt
attaagctccaatacacaaggaaaatcattgatgctattcactccggaagtctcctgaat
gcagagtacaagaagactgaaatttttgggcttgagatccccaccgaagtggagggtgta
ccttctgaaatcctggacccagtgaacacttggtcaaacaaaaaggcatacaaggagacg
ctactgaagttggctggattgttcaagaacaattttgaaaccttcaccagccacaagatt
ggcaagggcaacaacaacctgacagaagagattctcgccgctggtccaatcttttga

DBGET integrated database retrieval system