KEGG   Vigna radiata (mung bean): 106779569Help
Entry
106779569         CDS       T04126                                 

Definition
(RefSeq) probable mediator of RNA polymerase II transcription subunit 37c
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
vra  Vigna radiata (mung bean)
Pathway
vra03040  Spliceosome
vra04141  Protein processing in endoplasmic reticulum
vra04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:vra00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    106779569
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    106779569
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    106779569
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:vra01009]
    106779569
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:vra03041]
    106779569
   03009 Ribosome biogenesis [BR:vra03009]
    106779569
   03110 Chaperones and folding catalysts [BR:vra03110]
    106779569
   04131 Membrane trafficking [BR:vra04131]
    106779569
   03051 Proteasome [BR:vra03051]
    106779569
   03029 Mitochondrial biogenesis [BR:vra03029]
    106779569
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:vra04147]
    106779569
Protein phosphatases and associated proteins [BR:vra01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     106779569
Spliceosome [BR:vra03041]
 Complex B
  Other components
   Prp19 complex
    106779569
 Complex C
   Prp19-CDC5 complex
    106779569
Ribosome biogenesis [BR:vra03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    106779569
Chaperones and folding catalysts [BR:vra03110]
 Heat shock proteins
  HSP70 / DNAK
   106779569
Membrane trafficking [BR:vra04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    106779569
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    106779569
Proteasome [BR:vra03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    106779569
Mitochondrial biogenesis [BR:vra03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    106779569
Exosome [BR:vra04147]
 Exosomal proteins
  Proteins found in most exosomes
   106779569
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C Med15_fungi
Motif
Other DBs
NCBI-GeneID: 106779569
NCBI-ProteinID: XP_014523180
UniProt: A0A1S3VXY3
Position
Unknown
AA seq 619 aa AA seqDB search
MAEDKKGLSIGIDLGTTYSCVAVWQQQHNRVEIIHNDQGNNTTPSCVAFTDHERLIGDPA
TNQAAFNPENTIFDAKRLIGRKYSDPLVQKDKMLWPFKVVAGVNDKPMISVKYKGQEKSL
CAEEISSMILSKMRDIAEAYLEKPVKNAVVTVPAYFNDSQRKATMDAGTIIGLNVIRIIN
EPTAAAIAXGLDKRNDCVGQRNIFVFDFGGGTFDVCILTIENKVFQVKATAGNTHLGGED
IDNRMMNYFVEEMKRKSKVDISANPRALRRLKSACERAKRTLSYAVTANIEVDNLFPGID
LCSSITRAKFEXINCDLFEECMETVDRCLKDAKMEKSSVHDVVLVGGSSRIPKMQQLLED
FFNRKDLCKSVNPDEAVAYGAAVQAALLNEGIKNVPNLVLKDVTPLSLGISIQGDLMSVL
IPRNTTIPIKKKQVFLTCQDDQFSVKIKVYEGERVKASDNDLLVSFSIFGFPPARRGYPF
YVTFAINENGILSVSAEEIVTGNRDEIIISHKGRLSNEKISEMIKEAENYKFEDEKFLKK
AKAMNDLDDHVYKIKKALKKKDISSKLSSKEKEDICSKISRATDMLDRRNEMEDIVAIED
FLKNLKAISERIMVMEKIV
NT seq 1860 nt NT seq  +upstreamnt  +downstreamnt
atggccgaagacaaaaagggattatcaataggaatcgaccttggcacaacatactcctgt
gttgcagtatggcagcaacaacataatagggtggagatcattcataatgatcaaggcaac
aataccactccttcttgtgttgcttttacggaccatgaaaggttgataggagatcctgct
acaaatcaggctgctttcaatccagagaacaccatctttgatgctaagaggttgataggt
aggaaatacagtgacccacttgttcagaaagacaaaatgttgtggccatttaaggttgtt
gccggtgtcaatgacaaacccatgatttctgttaagtacaaaggtcaggagaagagcctt
tgtgcggaggaaatatcatccatgatcctctcaaagatgcgggacattgcagaggcatac
ttggaaaagcctgtgaagaatgcggtggttactgtgcctgcctatttcaatgattctcag
cgcaaagccaccatggatgctggtactattataggtcttaatgtcattcgtataatcaat
gaaccgacagctgcagcaattgcatanggtcttgataaaagaaatgattgtgttggacag
cgaaatatttttgtttttgattttggaggtggtacattcgatgtgtgtattctcactatt
gagaacaaagtctttcaagttaaggccactgccggaaacactcaccttggcggagaggac
attgataatagaatgatgaactactttgtggaggagatgaaaagaaaaagtaaagttgac
ataagtgcgaatccacgtgccttaaggaggttgaaaagtgcttgtgagagagcaaaaagg
acactctcatatgctgttactgcaaacattgaggtagataatttatttccaggcattgat
ttatgttcttcaataacccgagcaaaatttgaacanatcaattgtgatctctttgaagag
tgtatggaaacagtagataggtgtcttaaggatgctaagatggagaaaagtagtgtgcat
gatgttgtccttgtcggtggttcttctaggattcccaaaatgcagcagctacttgaggac
tttttcaataggaaggatctttgcaagagcgtaaaccctgatgaggctgttgcttatggt
gcagctgtgcaggctgctctcttgaatgaaggcattaagaatgttccaaatttggtattg
aaagatgttactccgctatcacttggcatatctatacagggggatttgatgagtgttttg
attcctaggaatacaactattcctataaagaagaaacaagttttcctgacatgccaagat
gaccaattctcagtcaagattaaggtttatgagggcgagagagtgaaagccagtgataat
gatttgttggtttctttttctatttttggctttcccccagctcgtcgtggctatcctttt
tatgtgacttttgcaataaatgaaaatggcattctttccgtttctgctgaggaaatagta
accggtaatagggatgaaattataatatcccataaaggaagactatcaaatgaaaaaatt
agtgaaatgattaaagaagcagagaactataagtttgaagatgagaagtttcttaagaag
gccaaagcaatgaatgatttagatgatcatgtttataagatcaaaaaggccttaaagaag
aaggatatcagctcaaagttgagttcgaaagaaaaggaagatatctgttctaaaatttct
agagccactgatatgcttgataggcggaacgagatggaagatatagttgctattgaagac
tttctgaaaaatcttaaagcaatcagtgaacgaattatggtcatggagaagattgtctag

DBGET integrated database retrieval system