KEGG   Vigna radiata (mung bean): 106779595Help
Entry
106779595         CDS       T04126                                 

Definition
(RefSeq) vestitone reductase
  KO
K13265  vestitone reductase [EC:1.1.1.348]
Organism
vra  Vigna radiata (mung bean)
Pathway
vra00943  Isoflavonoid biosynthesis
vra01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:vra00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00943 Isoflavonoid biosynthesis
    106779595
Enzymes [BR:vra01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.348  (3R)-2'-hydroxyisoflavanone reductase
     106779595
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Epimerase 3Beta_HSD GDP_Man_Dehyd NAD_binding_4 NAD_binding_10 NmrA KR Polysacc_synt_2 adh_short Phage_FRD3
Motif
Other DBs
NCBI-GeneID: 106779595
NCBI-ProteinID: XP_014523221
UniProt: A0A1S3VXW8
Position
Unknown
AA seq 327 aa AA seqDB search
MAETKGTVCVTGGTGFIGSWIIKSLLEHGYSVNTTIRSDPGRKRDVSFLTNLPGASEKLR
FFNADLSDPESFGPAVEGCVGIFHTATPIDFAVNEPEEVVTKRAIEGALGILKAAVKAKS
VKRVVYTSSASTVSFTGSEPQDVVDESAWSDVDLLRKLKPFSWSYTISKVLTEKAVFEFG
EQNGLEVVSLVPPFVVGRFICPKLPDSVERALLLLFGKKEEIGVIRYHMVHVDDLARAHI
FLLEHPNPKGRYNCSPFIVPIEEIAEIISTKYPEFQIPSVEEAKEIKGAKLPHLDSQKLV
DAGFEFKYSVEDIFTDAIECCKQNGYL
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atggcagagacaaaaggcacagtttgtgtcactggaggcacaggcttcattggttcatgg
atcatcaagtcactccttgaacatggatattctgttaatacaactattagatctgaccca
ggacgcaagagggatgttagctttctcacaaatctacctggtgcatcagaaaagctacgt
tttttcaacgctgatctaagtgacccagagagttttggtccagcagtagaagggtgtgta
gggatttttcacactgccacaccgattgattttgcagtgaacgagccagaagaagttgtg
accaaaagggccattgagggagcactgggaatactgaaagcagctgtgaaagcaaagtca
gtgaagagggttgtctacacttctagtgcttctactgtttccttcactggctcagagcca
caagatgtggttgatgaaagtgcttggagtgatgttgatttgctcaggaagttgaagcct
ttcagttggtcatatacaatttcaaaggtgttgacagaaaaggcagtgtttgagtttgga
gaacagaatggattggaagttgtgagtcttgtgcctccctttgttgttggacgtttcatc
tgtcccaagcttcctgactctgttgaaagagcactgcttttgttgtttggcaaaaaggaa
gaaattggagtgattcgttaccatatggttcatgtggatgatttggctagagcacatatc
tttctgctagagcatcctaatcccaaagggagatataactgttcacccttcattgtaccc
attgaagagattgctgaaattatttcaaccaaatacccagaatttcaaataccatctgta
gaagaggcgaaggaaataaaaggtgccaagttgccacatttagactcccagaaactggtg
gatgctggctttgagttcaagtatagtgtggaggacatttttactgatgcaattgaatgc
tgcaagcaaaatggttatctttaa

DBGET integrated database retrieval system