KEGG   Veillonella rodentium: 44547418_01345Help
Entry
44547418_01345    CDS       T05216                                 

Gene name
mtnW
Definition
(GenBank) 2,3-diketo-5-methylthiopentyl-1-phosphate enolase
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
vrm  Veillonella rodentium
Pathway
vrm00630  Glyoxylate and dicarboxylate metabolism
vrm01100  Metabolic pathways
vrm01110  Biosynthesis of secondary metabolites
vrm01120  Microbial metabolism in diverse environments
vrm01130  Biosynthesis of antibiotics
vrm01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:vrm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    44547418_01345 (mtnW)
Enzymes [BR:vrm01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     44547418_01345 (mtnW)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large
Motif
Other DBs
NCBI-ProteinID: SNV70213
UniProt: A0A239ZGY8
Position
1:complement(1437596..1438780)
Genome map
AA seq 394 aa AA seqDB search
MKSERFIVTYRIAANSYDDAKAIAEAVQVEQTIEFPYEFVTDEYIKEHITGQLVSLEPMK
GDSPYATVGVMPEQTVLEESYYVARISYAVETTAMEATQFLNVIFGNSSLQPYIWVVDIE
LCPSLYAKFKGPRFGLTGIRNLVGTPKRPMIQAVIKPMGTSSAELARMCGAYTRGGADVI
KDDHGISNQSFSEFRDRISRCAYTVQEMNAAHGTKTLYAANISGDGPEVMERAQFAKEAG
ATALMVASGLIGFGWLHVLATDETLGLPIINHPALSGCYVSPGISGVADYLQLGLFPRLF
GADMPIFVSYGGRFTFTQDQCQRISRYIKNPTGPLKAACPAPGGGITDTRLAELVGLYGN
DTMFLVGGDMFRRGPDIESNMAYFVNRLDELSDL
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgaagagcgagcgatttatagttacgtatcgaatagcagcaaacagttacgatgatgca
aaagctattgccgaggccgtgcaagtggagcaaacgatcgagtttccctacgaatttgta
acggatgaatatattaaagagcacataacgggacagttggtgtcattagaaccgatgaaa
ggtgattcgccctatgcaacggtgggagtgatgccggaacaaaccgtgttggaggagtct
tactatgtggcacgtatatcctacgcggtagaaacgacagcaatggaggcgactcagttt
cttaatgtcatcttcgggaattcatcattacaaccttatatctgggtagttgatatagaa
ttatgcccttcattatatgcgaaatttaaggggccgcgcttcggactaacggggattaga
aatcttgtgggaactccgaagcggcctatgattcaagctgttatcaagcctatggggaca
tctagtgcagagctggcgcgtatgtgcggcgcatatacacgtggcggtgcggatgtgatt
aaagatgatcacggtatctccaatcagtccttttctgaatttcgtgatcgcatttcccgt
tgtgcctatacggtacaggagatgaatgccgctcatggtacaaagaccttatatgcggcc
aatatatccggtgatggtcctgaggttatggagcgggcacagtttgcaaaggaagcaggt
gcgacagccctcatggtggcctccggtttgataggttttggatggttacatgtgttggct
acggatgaaacattaggcctgccgattatcaatcatcctgcgctctcgggatgttatgtg
agtccgggaatatccggtgtggctgattatttacagttgggcttgtttcctcgattgttc
ggtgccgatatgccgattttcgtgtcttacggcggacgttttactttcacacaggatcaa
tgccaacggattagcagatatataaaaaatcctaccgggcctttgaaagctgcatgtccg
gcgccgggagggggcattaccgatacgaggttagctgaattggtcggcttatacgggaac
gatacgatgttcctcgtcggcggcgatatgttccgtcgaggtcctgatattgaatcgaat
atggcgtattttgtgaatcgtttagatgaactatccgatttataa

DBGET integrated database retrieval system