KEGG   Veillonella rodentium: 44547418_01724Help
Entry
44547418_01724    CDS       T05216                                 

Gene name
rluC
Definition
(GenBank) Ribosomal large subunit pseudouridine synthase C
  KO
K06180  23S rRNA pseudouridine1911/1915/1917 synthase [EC:5.4.99.23]
Organism
vrm  Veillonella rodentium
Brite
KEGG Orthology (KO) [BR:vrm00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:vrm03009]
    44547418_01724 (rluC)
Enzymes [BR:vrm01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.23  23S rRNA pseudouridine1911/1915/1917 synthase
     44547418_01724 (rluC)
Ribosome biogenesis [BR:vrm03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    44547418_01724 (rluC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2 Frtz
Motif
Other DBs
NCBI-ProteinID: SNV74527
UniProt: A0A239ZU53
Position
1:complement(1832803..1833939)
Genome map
AA seq 378 aa AA seqDB search
MARKTHRPDDMLWTVSAEDIRIASYDDSDYLHHATIDANGDDTNAENRLNKPNALNTLNS
GVAVNNKSDVMDTVALGRLLDTRYPRKSMVKLFDEKLIHINEYKAMPHDEVSAGDEIRIA
MAKEKLDYEPVPMDLVILYEDDDLLVVDKPAGMTVNSKGQVSLANGVAHYFKEHGIKRKV
RFLNRLDRDTTGCIIIAKSGLAQSLYQQQMDSDVFEKWYVATVEGLIADDSGSLEFPMEK
ASDGIHYEVSPNGKNTRTDFIVLHRCAARAVDNSVNNRKKSVDRVDENVDIAHRDVDKSG
LIVDNVVDNCLPDAYTDVSVRLYTGKTHQIRVAFSHIGHPLVGDTLYGAMATGTAFKLRA
EKIVFTHMRTGERITVTA
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atggcgcgaaagactcatcgtcccgatgacatgttgtggactgtcagtgcagaggatata
cggatagcctcctatgatgacagtgattatttgcatcatgctacgattgatgctaatggt
gatgatacgaatgcggaaaataggttaaataagccgaatgcattaaacacgctgaactct
ggtgttgcggttaataataagagtgatgttatggatactgttgctttaggtcgtctgctg
gatacgagatacccgcgtaaatccatggtgaaactgtttgatgaaaagttgattcatatt
aacgaatataaagctatgccccatgatgaggttagtgcgggtgacgaaatccggatcgcc
atggcgaaggagaaacttgattatgaaccggtccctatggacttagtaatcctgtatgag
gatgatgatttgctcgttgttgataagcccgcagggatgacggtgaattcaaaggggcag
gtatcacttgcgaatggggtggctcattattttaaagagcatggtatcaaacgaaaagtg
cggtttttaaatcgccttgatcgggatacgacgggatgtatcatcatagctaagagcggt
ctggctcaaagcttatatcaacagcagatggatagtgatgtatttgaaaaatggtatgtt
gccactgtggaagggcttatagccgatgattccggttctcttgaatttcctatggagaaa
gcctctgacggcattcattatgaagtcagtccgaacggaaagaacacgcgcaccgatttt
atcgttttgcacagatgtgcggcacgggctgtggataactctgtgaataaccgtaaaaaa
tctgtggatagagtggatgaaaatgtggatatagcacatcgggatgtggataaatcaggt
ctgattgtggataatgtggtggataactgtttgccggatgcatatacggatgtatctgtg
cgcttatatacgggaaaaacacatcagattcgcgtggctttcagccatataggacaccct
cttgtaggggatacgttgtacggtgcgatggcgacaggaaccgctttcaagttgcgcgcc
gagaaaattgtatttacacatatgcggaccggagaacgaattaccgtgaccgcttag

DBGET integrated database retrieval system