KEGG   Vibrio rotiferianus: BSZ04_08300Help
Entry
BSZ04_08300       CDS       T05115                                 

Definition
(GenBank) cobyric acid synthase CobQ
  KO
K02232  adenosylcobyric acid synthase [EC:6.3.5.10]
Organism
vro  Vibrio rotiferianus
Pathway
vro00860  Porphyrin and chlorophyll metabolism
vro01100  Metabolic pathways
Module
vro_M00122  Cobalamin biosynthesis, cobinamide => cobalamin
Brite
KEGG Orthology (KO) [BR:vro00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BSZ04_08300
Enzymes [BR:vro01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.10  adenosylcobyric acid synthase (glutamine-hydrolysing)
     BSZ04_08300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_3 CbiA AAA_26 MobB BPL_N MeaB
Motif
Other DBs
NCBI-ProteinID: ASI94996
Position
1:1813423..1814874
Genome map
AA seq 483 aa AA seqDB search
MKSPIPSLMVQGTTSDAGKSVLVAGLCRVLARRGVKVAPFKPQNMALNSAVTKDGGEIGR
AQAVQAQACNVEPTVHMNPVLIKPNSDTGAQIILQGKALSNMDAVGFHDYKKVAMGTVLG
SFAQLTDEYESIMIEGAGSPAEINLRENDIANMGFAEEADVPVIIIADIDRGGVFAHLYG
TLALLSESEQARVKGFVINRFRGDISLLESGLDWLEEKTGKPVLGVLPFLHGLNLEAEDA
ITAEQELSSRVKLNVVVPVLTRISNHTDFDVLRLNPDINLRYVGKGEKIDKADLVILPGT
KSVRDDLDYLRSQGWDKDIQRHIRLGGKVIGICGGYQMLGKIIDDPNGVEGTPGQSEGLG
VLDVNTILTNSKQLTHTQAQICLNGKTVDVKGYEIHVGRSEVQGAQPMTLSSGEAEGAIS
ECGQVMGTYLHGFFDEADVLSLVAEWVNGTQIKQQDFEELKEQGINRIADAIEQHMNLDF
LFK
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcaccaatcccatcattaatggttcaaggcacaacttcagatgccggaaaaagt
gtccttgtggcaggtttatgccgtgtgttggcaaggcgaggggtaaaagttgccccattc
aagccacagaatatggctctgaatagtgcagttaccaaagatggcggagaaattgggcgt
gctcaagccgttcaggcgcaagcttgcaacgttgagcctacggttcacatgaatcctgtg
ctaattaagcctaatagcgacacaggtgctcagatcatcttacaaggcaaagcattgtcg
aatatggacgcagtcgggtttcatgattataagaaagtggcaatgggaacggtgctgggt
tcatttgcacaactgacggacgaatacgaatccattatgattgaaggtgctggcagccca
gcagaaatcaacttaagagaaaatgacatcgctaacatgggctttgctgaagaagccgac
gttccagtcattattattgcggatatcgaccgtggtggtgtatttgcccatctgtacggg
acgctagcattactatccgaatctgaacaagctcgcgttaaaggcttcgtaataaaccgt
ttccgtggcgatatcagcttgcttgaatctggtcttgattggttagaagaaaagacaggc
aaaccagtgttgggggtattgccgttcttgcatggtttaaacctagaggcagaagacgct
ataacggcagagcaagagctatcttcacgcgttaaactcaatgttgtggtgcccgtatta
acacgcattagtaatcataccgattttgatgtgttgcgtcttaatccagacattaacctt
cgctacgttggtaaaggcgaaaagatcgacaaagccgatttggttatcttgccgggcact
aagtcagttcgcgacgatttggattatctgcgtagccaaggctgggataaagacattcaa
cgccatatccgacttggcggaaaagtcattggtatctgtggtggctaccaaatgcttggt
aagattattgacgatcccaatggtgtggaaggcacccctggccaaagtgaagggttaggg
gtgttagacgtcaatacgattctaaccaacagcaaacaattaacgcatacacaagcgcag
atttgcctaaacggtaaaactgtagatgtgaaaggctacgaaattcatgttggtcgaagt
gaagtgcagggcgctcaacctatgacattgagttctggcgaagcagagggcgcgataagt
gagtgtggccaagtaatgggaacataccttcacgggttctttgatgaggcggacgtttta
agccttgtggctgaatgggtaaacgggactcaaatcaaacaacaagactttgaagagtta
aaggaacaaggcattaatcgcattgcagatgcgatagaacaacatatgaatcttgacttt
ctgttcaaataa

DBGET integrated database retrieval system