KEGG   Vibrio rotiferianus: BSZ04_17300Help
Entry
BSZ04_17300       CDS       T05115                                 

Definition
(GenBank) phosphatase
  KO
K07053  3',5'-nucleoside bisphosphate phosphatase [EC:3.1.3.97]
Organism
vro  Vibrio rotiferianus
Brite
KEGG Orthology (KO) [BR:vro00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BSZ04_17300
Enzymes [BR:vro01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.97  3',5'-nucleoside bisphosphate phosphatase
     BSZ04_17300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHP IPPT
Motif
Other DBs
NCBI-ProteinID: ASI96696
UniProt: A0A2K7SVL2
Position
2:complement(1810222..1811100)
Genome map
AA seq 292 aa AA seqDB search
MRIDLHSHTTASDGRFAPHDLVDRALSFDIEVLAITDHDTVDGLAPAKQYVEENNLPIKI
INGIEISTVWQNKDIHIVGLNIDPDSPALTELIEQQKTHRVARAELIAERLQKATREGVL
EEVQQIAGDAPITRAHFAKWLVDNGYAKNMQMVFKKFLTRSNPGYVPPNWCSMKDAVDAI
HAAGGSAVLAHPGRYQLTAKWVKRLLAAFVEAGGDAMEVAQPQQAQQERRNLADYAIQYK
LLASQGSDFHYPSPWMELGRNLWLPAGVEPVWKDWGIDPSLDNKQQDEVETP
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgagaattgatttacacagccacactacggcatcagatggtcgatttgcaccacatgat
ttagtggatagggcattgagttttgatatcgaggttttggcgatcacggatcatgatacg
gttgacggcttagctccggccaagcaatacgttgaagagaacaatctcccgataaaaatc
atcaacggtatcgagatctctaccgtttggcagaacaaagacatccacattgtggggttg
aatatcgatccagatagcccagcattgacggagctgattgagcagcagaaaacgcaccgc
gtggctcgagctgaattgatcgctgagcgtctacaaaaagccacccgtgagggcgtacta
gaagaagtccagcaaattgcaggtgatgcgcccattacacgagctcacttcgccaaatgg
ctggtggacaatggttacgccaaaaacatgcagatggtgtttaagaaattcctgacgcgc
tctaaccctggctatgtaccaccgaattggtgttccatgaaagatgcggttgacgcgatt
catgccgcgggtggttctgctgtattggctcatccgggtcgttatcagcttaccgcaaag
tgggtaaaacgcttgttagcggcatttgtcgaagcaggcggagatgccatggaagttgcg
caacctcaacaagcgcaacaagaaagacgcaacttggccgattatgctatacaatacaaa
ctattagcttctcaaggcagcgattttcactatccatcaccgtggatggagttgggaaga
aacctctggttacctgcgggcgtagaaccagtttggaaagattggggtattgatccttcg
ttggacaataagcaacaagacgaagtcgaaactccctaa

DBGET integrated database retrieval system