KEGG   Aliivibrio salmonicida: VSAL_I0210Help
Entry
VSAL_I0210        CDS       T00782                                 

Gene name
gmk
Definition
(GenBank) 5'guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
vsa  Aliivibrio salmonicida
Pathway
vsa00230  Purine metabolism
vsa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vsa00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    VSAL_I0210 (gmk)
Enzymes [BR:vsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     VSAL_I0210 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin ABC_tran RsgA_GTPase AAA_33 AAA_16 MMR_HSR1 AAA_22 AAA_29 cobW
Motif
Other DBs
NCBI-ProteinID: CAQ77895
UniProt: B6EPJ2
Position
1:250943..251566
Genome map
AA seq 207 aa AA seqDB search
MSKGTLYIVSAPSGAGKSSLISALIESNPTYAMKVSVSHTTRGMRPGEQDGVHYHFMQKE
HFEDLIEKEEFLEYAEVFGNYYGTSRVWIEETLDKGIDVFLDIDWQGARQIRIQMPLAKS
LFILPPSNGELERRLNVRGQDSEAVIAKRMSEAKSEISHYNEYDYVIINDDFDTAQMDFK
AIIRAERLKQDKQTSKYKGMLSALLAD
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaaggtacactttatattgtttcagccccaagtggcgctggtaaatcaagcttg
atctctgcattaatagagagcaaccctacttatgcaatgaaagtctctgtctctcatacc
actcgtggcatgcgtcctggcgaacaagatggtgttcattaccattttatgcagaaagag
cattttgaagatctgatcgaaaaagaagagtttttggaatatgccgaagtatttggtaat
tattacggaacttctcgcgtttggatcgaagaaacgttagataaaggcattgatgtattt
ttggatattgattggcaaggtgctcgtcaaattcgcatacaaatgcctttagcaaaaagc
cttttcatcttaccaccttcaaatggtgaacttgagcgtcgactaaatgttcgcgggcaa
gacagtgaagcggtcattgcgaaacgaatgagcgaagcaaaatcagaaatttctcactat
aatgaatatgattatgtgattattaatgacgattttgatactgcacaaatggattttaaa
gctattatccgtgcagagcgcttaaaacaagataaacaaacatcaaaatataaaggcatg
ttgtcagctcttttagccgattaa

DBGET integrated database retrieval system