KEGG   Aliivibrio salmonicida: VSAL_I0359Help
Entry
VSAL_I0359        CDS       T00782                                 

Gene name
mdh
Definition
(GenBank) malate dehydrogenase
  KO
K00024  malate dehydrogenase [EC:1.1.1.37]
Organism
vsa  Aliivibrio salmonicida
Pathway
vsa00020  Citrate cycle (TCA cycle)
vsa00270  Cysteine and methionine metabolism
vsa00620  Pyruvate metabolism
vsa00630  Glyoxylate and dicarboxylate metabolism
vsa00680  Methane metabolism
vsa01100  Metabolic pathways
vsa01110  Biosynthesis of secondary metabolites
vsa01120  Microbial metabolism in diverse environments
vsa01130  Biosynthesis of antibiotics
vsa01200  Carbon metabolism
Module
vsa_M00009  Citrate cycle (TCA cycle, Krebs cycle)
vsa_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
vsa_M00012  Glyoxylate cycle
vsa_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:vsa00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    VSAL_I0359 (mdh)
   00620 Pyruvate metabolism
    VSAL_I0359 (mdh)
   00630 Glyoxylate and dicarboxylate metabolism
    VSAL_I0359 (mdh)
  Energy metabolism
   00680 Methane metabolism
    VSAL_I0359 (mdh)
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    VSAL_I0359 (mdh)
Enzymes [BR:vsa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.37  malate dehydrogenase
     VSAL_I0359 (mdh)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ldh_1_C Ldh_1_N Semialdhyde_dh
Motif
Other DBs
NCBI-ProteinID: CAQ78044
UniProt: B6EL39
Position
1:394789..395724
Genome map
AA seq 311 aa AA seqDB search
MKVAVIGAAGGIGQALALLLKNRLPAGSDLALYDIAPVTPGVAADLSHIPTPVSIKGYCG
EDPTPALEGADVVLISAGVARKPGMDRSDLFNINAGIVKSLAEKIAVTCPKACIGIITNP
VNTTVAIAAEVLKKAGVYDKNKLFGVTTLDVIRSETFVAELKGKNPGEICVPVIGGHSGV
TILPLLSQVEGVEFTAEEVAALTPRIQNAGTEVVEAKAGGGSATLSMGQAACRFGLSLVK
ALSGEKGVVECAYVEGNGEHARFFAQPILLGKNGVEEIQHYGELSTFEQDALDSMLDTLK
ADIKIGEEFIK
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgaaagttgctgttattggcgccgctggaggcatcggacaagcattagcattacttctt
aagaatcgattaccagccggctcggatcttgctctttatgatattgcaccggtaacccct
ggggttgctgcggatcttagtcatatcccaacaccagtttcaattaaagggtattgcgga
gaagatccaacaccagcacttgaaggcgctgatgttgttttaatttctgctggtgttgct
cgtaaaccaggaatggatcgttcagatcttttcaatattaatgcgggtattgttaagtca
ttggctgaaaaaattgcagtgacttgtccaaaggcatgcattggtattattactaaccct
gttaatacaaccgtggcaattgctgctgaagtattaaaaaaagcaggtgtatacgataaa
aataaattgtttggcgtaaccacactggatgtgatccgttcagagacgtttgtggctgag
ttaaaaggtaaaaatccaggagagatctgtgttcctgttattggtgggcattctggtgtt
acgattcttcctctgctttcacaagttgagggtgttgagttcaccgctgaagaagtggca
gcattaacaccgcgtattcaaaacgcaggaacggaagttgtggaagctaaagctggtggc
ggttctgcgacactttcaatgggccaagcggcatgtcgctttggtttatcactagtaaaa
gcgcttagtggtgagaaaggggttgtagaatgtgcgtatgttgaaggcaatggtgaacac
gctcgtttcttcgcgcaacccattcttcttggtaaaaatggtgttgaagagattcaacac
tatggcgaattaagtacttttgaacaagatgcactagatagcatgctagatacgttaaaa
gcggatattaaaattggcgaagaatttattaagtaa

DBGET integrated database retrieval system