KEGG   Aliivibrio salmonicida: VSAL_I0830Help
Entry
VSAL_I0830        CDS       T00782                                 

Gene name
nagA
Definition
(GenBank) N-acetylglucosamine-6-phosphate deacetylase
  KO
K01443  N-acetylglucosamine-6-phosphate deacetylase [EC:3.5.1.25]
Organism
vsa  Aliivibrio salmonicida
Pathway
vsa00520  Amino sugar and nucleotide sugar metabolism
vsa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    VSAL_I0830 (nagA)
Enzymes [BR:vsa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.25  N-acetylglucosamine-6-phosphate deacetylase
     VSAL_I0830 (nagA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidohydro_1 Amidohydro_3
Motif
Other DBs
NCBI-ProteinID: CAQ78515
UniProt: B6EHL5
Position
1:complement(924571..925707)
Genome map
AA seq 378 aa AA seqDB search
MYALTNCKVYTGNDVLVDHSVIINGTNIEKICLTSELPDGIERKDLDGANLSPGFIDLQL
NGCGGVMLNDEITAKTMQIMHEANLKSGCTSFLPTLITSSDEDMRASIEAAREYHNKYQN
QSLGLHLEGPYLNVMKKGIHSVDHIRHSDSDMIQLMCDNADLITKVTLAPEQNDPEHIER
LHKAGIVVSIGHTNATYAEARQGFESGITFATHLFNAMTPMVGREPGVVGAIYDTPDVYA
GIIADGFHVDYANIRIAHKIKKEKLVLVTDATAPAGADMEYFIFVGKKVYYKDGKCVDEN
GTLGGSALTMIEAVQNTVEHVGIALDEALRMATLYPAQAIGVDNKLGRIKKDMVANLAIF
DRDFNVKATVVNGQYEQS
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atgtatgcgctaactaactgtaaagtctatactggtaatgatgttcttgttgatcactca
gtgattatcaacggcaccaatattgaaaaaatctgcctaacatctgaacttcctgatggc
atcgaacgtaaagatttagacggtgctaatttaagccctggtttcatcgaccttcagcta
aatggctgtggtggtgtaatgctaaatgatgaaattacagcaaaaaccatgcaaataatg
catgaagcaaaccttaaatcaggttgtactagctttttacctacattaatcacttcttca
gacgaagatatgcgcgcttctattgaagctgctcgtgaatatcacaataaatatcaaaac
caatctttaggtttacaccttgaaggtccgtacctaaatgtcatgaaaaaaggcattcac
agcgttgatcatatccgtcactcagattcagatatgatccaacttatgtgtgataacgct
gatttaatcaccaaagtgacattggctcctgagcaaaatgatcctgaacatattgagcgt
cttcacaaggctggtattgttgtttcaattggccacacaaacgcaacgtatgctgaagct
cggcaaggttttgagtcaggcattacattcgctactcatttatttaatgcaatgacacca
atggtaggtcgcgaaccaggtgttgttggtgccatctacgatacaccagacgtttatgct
ggcattatcgctgatggcttccatgttgattacgcaaacattcgtatcgcgcacaaaata
aagaaagaaaagttagtattagtgaccgatgccacagctcctgcaggtgctgacatggaa
tactttatttttgtggggaagaaagtatattacaaggatggtaaatgtgttgatgaaaat
ggcacattaggtggctcagctctgactatgattgaagcagttcagaatacagttgaacac
gttggaatcgctttagatgaagctctacgtatggctacgttatatcctgctcaagcaatt
ggtgtagataataaacttggtcgaatcaaaaaagacatggtagctaaccttgctattttt
gatcgtgactttaatgtaaaagcgactgttgttaacggacaatacgagcaaagttaa

DBGET integrated database retrieval system