KEGG   Aliivibrio salmonicida: VSAL_I1121Help
Entry
VSAL_I1121        CDS       T00782                                 

Gene name
vasA
Definition
(GenBank) putative type VI secretion protein VasA
  KO
K11896  type VI secretion system protein ImpG
Organism
vsa  Aliivibrio salmonicida
Brite
KEGG Orthology (KO) [BR:vsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:vsa02044]
    VSAL_I1121 (vasA)
Secretion system [BR:vsa02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   VSAL_I1121 (vasA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_TssF
Motif
Other DBs
NCBI-ProteinID: CAQ78806
UniProt: B6EJ75
Position
1:complement(1222512..1224263)
Genome map
AA seq 583 aa AA seqDB search
MSFNTYYQTELAALRELGKSFSEENPALAPFLGQEGLDPDIERLFEGFAFLVGRLHQRLD
NQLPELTHSLMRLLWPNYVQAIPAMSTLKFTPNAEATQCSTIPRGTKVKSQLIDGVHCQF
KTCYDVELYPISLHSSSFTANGNGGIYQLRLELPTGVELHSLNMNKLKIHFNGDKASSLS
LIMALCSSTTQAEFCALNSDNELINRSTFPTKSIKSVGFSSQEALYDYPLNTFEGYRHIQ
EFFCYPEKYYYIDLTELPVWPAQFSQGCKFIDIKFTLAHITQQPFYATRIQPALFCTPIV
NLFTTDTQPILLSHRKDQYKVTPSSLSDSSSTILSVEEVHGWTPGQKGRINFYHFESFEH
NDTNKHANYYSIKQEKNIVNGHFDTYLSFRSLNTFSNNITVSISVTACNGQLAQRLSVGS
ITHATEQTTGSATFSNIRAVTPCYTPPIEKDGLWSLISNMSLNYLSLTKPEAFKRILLAY
DFAGQQDDSRRKKHRRLIDGIKHITTKPSDMLYEGAPVRAMNTQLSLNSKHFLCEGELYL
FSSVINEFLSLYTSMNSFNQLNVTSTYGGDYSWQPRMGQQPLI
NT seq 1752 nt NT seq  +upstreamnt  +downstreamnt
atgagttttaatacctattatcaaacagaattagcggcattgagagagcttggaaaatca
ttttcagaagaaaatcccgccttagccccttttcttggacaagaagggttagatcctgat
attgaacgcttatttgaaggtttcgctttcttagtcggtcgattacatcaacgtcttgat
aatcaattacctgagttaacacattcattaatgcgattactttggcctaactatgttcaa
gcaattcccgcaatgagtacattgaaatttacaccgaatgcagaagcgactcaatgctca
actatcccccgagggactaaagtgaaaagtcagttaattgatggggttcattgtcagttc
aaaacctgctatgacgttgagttgtatccaattagtttacattcatcttcctttaccgcg
aatggaaatggcgggatctatcaactacgattagaattaccgacaggcgttgaattacat
tctttaaatatgaataaattaaaaattcattttaatggggataaagccagtagtctttca
ttaatcatggcactttgctcatccactactcaagccgaattttgtgcattaaatagcgat
aatgagttaattaatcggtctacctttccaaccaagagtatcaaatccgttggtttttca
tcgcaagaagcattatacgattatccattaaacacatttgaaggataccgtcatattcaa
gaattcttttgctatccagaaaaatattactacattgacttaactgaacttcctgtatgg
ccagctcagtttagtcaaggatgtaagttcatcgatatcaaatttaccttagctcacatt
actcaacagcctttttatgctactcgaatacaaccggctcttttttgcacacccattgtc
aatttattcacaacggatactcaaccgattttattaagtcatagaaaagatcaatataaa
gtaaccccatcctctttaagtgacagcagcagtactattttatccgttgaagaagtgcat
ggatggaccccgggacaaaaaggtcgcattaatttctatcattttgaatcttttgaacat
aacgatacaaataaacacgccaactattacagcatcaaacaagaaaaaaacattgtcaat
ggtcactttgatacatacttatcttttcgttcattaaatacattttcaaataacattacg
gtatcgattagcgttaccgcatgcaatggacaacttgcacaacgcttatccgtcggcagt
attactcatgcaacggaacagacaacaggatccgctaccttttcaaatattcgcgcagtc
acgccttgttatactccgccgattgaaaaggatgggctctggtctttgatctccaatatg
tctctcaattacctctcattaacaaagccagaagcatttaaacgcattttacttgcctat
gattttgcaggacaacaggacgactctagaagaaaaaaacatcgtcgattaattgatggt
atcaaacacatcacaacaaaaccttccgatatgctttatgaaggtgcgcctgttcgagca
atgaatacccaattatcacttaacagtaagcactttttatgcgaaggcgaactctacttg
ttttcatccgtaattaatgaatttttatcgctatacaccagcatgaactcattcaatcaa
ctcaatgtgacaagtacttatggaggcgactattcatggcaaccacgaatggggcaacaa
cctctaatttaa

DBGET integrated database retrieval system